DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4820 and ZIPIC

DIOPT Version :9

Sequence 1:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster


Alignment Length:293 Identity:60/293 - (20%)
Similarity:91/293 - (31%) Gaps:103/293 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KIEPIQLQMEEDPQAPYPENQ------------------LEQALSYGNAPGEDILPLPEDYGEAQ 163
            :||.:..::||:...|:.:.:                  |:.|:.|..:.|||    .|...|:.
  Fly   190 EIEEVAHEIEEEDLLPHDKQEAQEEDFFKEDTMSDFDEHLDGAIEYIISDGED----QEQDNESS 250

  Fly   164 TEVATTTNEP------AQRRSKNTAKIKSKKHTMRVGRKLIHVKVIDDKQPKRIVDRNGPS---- 218
            .|.......|      :.||:.|.       ||.|            :..|..:.|:.|.:    
  Fly   251 GEYTVNIQCPSCPEKFSSRRAYNV-------HTKR------------EHFPGYVCDQCGKTLQSY 296

  Fly   219 ------------AKPCICEHCGRQFKDTSNLHVHLLRHTGTKPFECDQCHQ-------------- 257
                        .|...|..|..:|.....|..|:..|:|..|::||.|.:              
  Fly   297 SGFIGHLQNHEPVKQFACPVCPERFSRKFRLKHHMAWHSGETPYQCDVCSKRFVHKVALYKHKMI 361

  Fly   258 ---------------KCYTLHLLRRHQLKHT-EGPYACTFCGLEYSTNSSRVRHEREACKKGRAP 306
                           |..|...|.||...|| :.|:||..|...:|...:...|.||....|   
  Fly   362 HDSETKRLECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCNKRFSQMYNMKAHLREHESPG--- 423

  Fly   307 QSKWEIIKKGERTFHCEVCDLWFLRAGNFTQHI 339
                   ....|.|||..|...|:...|:..|:
  Fly   424 -------TNRHRRFHCSKCTHTFINEQNYDAHV 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071
C2H2 Zn finger 224..244 CDD:275368 5/19 (26%)
C2H2 Zn finger 252..272 CDD:275368 8/48 (17%)
C2H2 Zn finger 279..297 CDD:275368 4/17 (24%)
C2H2 Zn finger 322..339 CDD:275368 4/16 (25%)
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 2/19 (11%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
zf-H2C2_2 327..351 CDD:290200 8/23 (35%)
C2H2 Zn finger 342..391 CDD:275368 8/48 (17%)
zf-H2C2_2 383..408 CDD:290200 9/24 (38%)
C2H2 Zn finger 399..419 CDD:275368 5/19 (26%)
C2H2 Zn finger 432..449 CDD:275368 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457231
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.