DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4820 and sqz

DIOPT Version :9

Sequence 1:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster


Alignment Length:278 Identity:66/278 - (23%)
Similarity:104/278 - (37%) Gaps:76/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QLQMEEDPQAPYPENQLEQAL--------------SYG--NAPGEDILPLPEDYGEAQTEVATTT 170
            |:.||   |.|:|:.|.:|.|              ||.  |:|     |.|.:    |.|.....
  Fly    69 QMVME---QQPHPDQQQQQHLHHPQQQQHPPQLKVSYSAPNSP-----PTPHE----QQEQKYDP 121

  Fly   171 NEPAQRRSKNTAKIKSKKHTMRVGRKLIHVKVIDDKQPKRIVDRNGPSAKPCICEHCGRQFKDTS 235
            |....|:..::|.......:.            .:::.:|   .:|..|||..|..|.:.|.::|
  Fly   122 NRSPPRQQMSSASGSGSNGSS------------PEEESRR---GDGDQAKPYKCGSCSKSFANSS 171

  Fly   236 NLHVHLLRHTGTKPFECDQCHQKCYTLHLLRRHQLKHT-EGPYACTF--CGLEYSTNSSRVRHER 297
            .|..|...|.|.||:.|:.|.:|...|..|::|...|| :.||.|..  |...:|..|:...|.|
  Fly   172 YLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHAGCPKAFSQLSNLQSHSR 236

  Fly   298 ----------EACKK---------GRAPQSKWEIIKKGERTFHCEVCDLWFLRAGNFTQHINSSS 343
                      .:|.|         ...|:.|   ..|..:|..|.:|      ..::||......
  Fly   237 CHQTDKPFKCNSCYKCFSDEMTLLEHIPKHK---DSKHLKTHICNLC------GKSYTQETYLQK 292

  Fly   344 HIEN--ERRKKRKSNPTA 359
            |::.  |:.:|::...||
  Fly   293 HLQKHAEKAEKQQHRHTA 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071
C2H2 Zn finger 224..244 CDD:275368 6/19 (32%)
C2H2 Zn finger 252..272 CDD:275368 6/19 (32%)
C2H2 Zn finger 279..297 CDD:275368 5/19 (26%)
C2H2 Zn finger 322..339 CDD:275368 4/16 (25%)
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 6/19 (32%)
zf-H2C2_2 172..197 CDD:290200 9/24 (38%)
zf-C2H2 186..208 CDD:278523 6/21 (29%)
C2H2 Zn finger 188..208 CDD:275368 6/19 (32%)
zf-C2H2_8 191..271 CDD:292531 19/82 (23%)
zf-H2C2_2 200..227 CDD:290200 8/26 (31%)
C2H2 Zn finger 216..238 CDD:275368 6/21 (29%)
C2H2 Zn finger 246..266 CDD:275368 3/19 (16%)
C2H2 Zn finger 277..297 CDD:275368 5/25 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.