DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4820 and CG31388

DIOPT Version :9

Sequence 1:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:458 Identity:114/458 - (24%)
Similarity:168/458 - (36%) Gaps:119/458 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKEFCRTCGKTVVADECL--QIFTPAGRKLLQCVRSITNCWLQNVQDLPNHICTDCQVLLSQVQK 63
            |:..||||.:  :||..:  .:|.|:...:|:.:.::||..|:....||..:|.|||..|.....
  Fly     1 MRYICRTCSR--MADPAVAKNLFDPSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAID 63

  Fly    64 FRRRCAKIEKYFARRRRRMNLGEAPAAMEQLRVQQA-AAPDPLGIDELMSASDIKIEPIQLQMEE 127
            |||.|.:.::....:.|::...|  .|.|.|..|.. ..||.|.          .:.|: ||:.:
  Fly    64 FRRVCIEAQELLELQLRQVEKEE--EAFESLAEQWLDDCPDELS----------NLSPV-LQLND 115

  Fly   128 ------DPQAPYPENQLEQA-------LSYGNAPGEDILPLPEDYGEAQTEVATTT--------- 170
                  ||: |..:|..|.|       ..|.||  ...:..|:...|..|:...:.         
  Fly   116 RMDFIFDPE-PQDKNTDELASIKTTTTTEYMNA--YQSVASPQSSPELSTDSQLSNEHFDMGLSP 177

  Fly   171 -NEPAQRRSKNTAKIKSKKHTM--------RVGRKLIHVKVIDDKQP--KRIVDR---------- 214
             :||......|  :..|..||.        .|....:|...:.|..|  |.:.|.          
  Fly   178 ESEPESEAIDN--RDTSSSHTCSKCGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAA 240

  Fly   215 --------NGPSAKPC----------------------------ICEHCGRQFKDTSNLHVHLLR 243
                    |.|....|                            :|..||:......||..||:|
  Fly   241 LTRHCNMINLPLTHSCTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVR 305

  Fly   244 HTGTKPFECDQCHQKCYTLHLLRRHQLKH-TEGPYACTF-CGLEYSTNSSRVRHER--------- 297
            |.||:..:||||....||...|..||..| ||.||.|.: ||..:...|:|..|||         
  Fly   306 HAGTRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRI 370

  Fly   298 ---EACKKGRAPQSKWEIIKKGE---RTFHCEVCDLWFLRAGNFTQHINSSSHIENERRKKRKSN 356
               |.|.|.....|:....:|..   |...||:|.:.|..|.::..|:.|::|...|.|.|..::
  Fly   371 YQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHKTLEARAKAAAS 435

  Fly   357 PTA 359
            |.:
  Fly   436 PNS 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071 23/72 (32%)
C2H2 Zn finger 224..244 CDD:275368 7/19 (37%)
C2H2 Zn finger 252..272 CDD:275368 9/19 (47%)
C2H2 Zn finger 279..297 CDD:275368 6/18 (33%)
C2H2 Zn finger 322..339 CDD:275368 5/16 (31%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 23/73 (32%)
C2H2 Zn finger 228..254 CDD:275368 3/25 (12%)
C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..334 CDD:275368 9/19 (47%)
C2H2 Zn finger 342..363 CDD:275368 8/20 (40%)
C2H2 Zn finger 373..393 CDD:275368 5/19 (26%)
C2H2 Zn finger 401..419 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.