DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4820 and M1BP

DIOPT Version :9

Sequence 1:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster


Alignment Length:412 Identity:102/412 - (24%)
Similarity:172/412 - (41%) Gaps:69/412 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKEFCRTCGKTVVADECLQIFTPAGRKLLQCVRSITNCWLQNVQDLPNHICTDCQVLLSQVQKFR 65
            :|..||.|.|........::|..:..|::..:.::|...|:|...||:.||..|.:.|:...|.|
  Fly     9 LKSTCRVCAKYASNKRSPKLFERSNTKMIDNIEALTGLRLENYGCLPDQICECCSMELASAVKLR 73

  Fly    66 RRCAKIEKYF-----ARRRRRMNLGEAPAAMEQLRVQQAAAPDPLGIDELMSA-SDIKIEPIQLQ 124
            .||...::..     ..:|:.::.....|.|.:..||....||.   ||:.:. .:|.:|..:.:
  Fly    74 ERCIAAQRELLLGLTEEQRQGISAFYRAAVMGEDIVQTVKTPDD---DEVYATYQEIVLEEPKEE 135

  Fly   125 MEEDPQAPYPENQLEQALSYGNAPGEDILPLPE--DYGEAQTEVATTTNEPAQRRSK-------- 179
            : :|.:..|.....|  ::.|:|..:|...|.|  ||.....|     :|..|:..:        
  Fly   136 I-DDTKVEYDNTYYE--VAEGHAGEDDAASLIEEADYDSIMAE-----DEEQQQTLELDEDTELI 192

  Fly   180 ----NTAKIKSKKHTMRVGRKLI-----HVKVIDDK-----QPKRIVD--RNGPSAKPCICEHCG 228
                |.|.:......:.|...::     |..::..|     :||...|  |...:....|||.||
  Fly   193 VGDVNDAYVYDSDDEVAVLDNVLDDEYEHENIVVKKCSLPPKPKVRSDDARRRGTGGVYICEQCG 257

  Fly   229 RQFKDTSNLHVHLLRHTGTKPFECDQCHQKCYTLHLLRRHQLKHT-EGPYACTFCGLEYSTNSSR 292
            ...|......:|..||.|.|.|.|:.|..:..|...|:||..||| |.|:||.:||..::..::|
  Fly   258 NHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRKHTGERPFACKYCGRCFTDYTTR 322

  Fly   293 VRHEREACKK--------GRAPQSKW-----EIIKKGERTFHCEVCDLWFLRAGNFTQHINSSSH 344
            |:|||....:        |:|..:.:     .:|..|||.:.||:||..|:...:.:.|..|..|
  Fly   323 VKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFMLPTHLSTHFRSGVH 387

  Fly   345 ------------IENERRKKRK 354
                        :|.|::::.|
  Fly   388 KRHLEKAEMKQVLEQEQKRELK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071 19/70 (27%)
C2H2 Zn finger 224..244 CDD:275368 6/19 (32%)
C2H2 Zn finger 252..272 CDD:275368 6/19 (32%)
C2H2 Zn finger 279..297 CDD:275368 6/17 (35%)
C2H2 Zn finger 322..339 CDD:275368 5/16 (31%)
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 19/70 (27%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
COG5048 276..>331 CDD:227381 22/54 (41%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 293..317 CDD:290200 12/23 (52%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
zf-H2C2_2 324..346 CDD:290200 5/21 (24%)
C2H2 Zn finger 337..357 CDD:275368 2/19 (11%)
zf-H2C2_2 350..372 CDD:290200 8/21 (38%)
C2H2 Zn finger 365..383 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.