DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4820 and nom

DIOPT Version :9

Sequence 1:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:402 Identity:87/402 - (21%)
Similarity:147/402 - (36%) Gaps:123/402 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRTCGKTVVADECLQIFTPAGRKLLQCVRSITNCWLQNVQDLPNHICTDCQVLLSQVQKFRRRCA 69
            ||.||::.:..:.:::|.|..:.:|:.::.||...||.:.:.|:.:|..||..|.....|||:|.
  Fly     6 CRVCGRSRLCPKAVELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIFRRQCI 70

  Fly    70 KIEKYFARRRRRMNLGEAPAAMEQLRVQQAAAPDPLGIDELMSASDIKIEPIQLQMEEDPQAP-- 132
                                      :||......|..|::.::.:.|:||      .||...  
  Fly    71 --------------------------LQQKKWVPLLQSDKVGASEEKKVEP------NDPSTKKK 103

  Fly   133 -------YPENQL---------EQALSYGNAPGEDILPLPEDYGEAQTEVATTTNEPAQRRSKNT 181
                   .|...|         |...|.|.:.|.|....|.:          .:|||....|.  
  Fly   104 TTKRRRGRPRMPLEIVDIVVTNESKASAGESVGGDEFDQPVE----------ISNEPDATDSD-- 156

  Fly   182 AKIKSKKHTMRVGRKLIHVKVIDDKQPKRIVDRNG-------PSAKPCICEHCGRQFKDTSNLHV 239
                            ::::.||      :.|.:|       |:.:...|:.||....:.|:|..
  Fly   157 ----------------VNLEEID------LPDEDGLESDHDLPNVQIHKCDTCGIIKNNKSSLVR 199

  Fly   240 HLLRHTGTKPFECDQCHQKCYTLHLLRRHQLKH--TEGPYACTFCGLEYSTNSSRVRHER----- 297
            |...|.|.:|:.|.:|.:.......|:.|.|.|  .|.|:||.:|...|.:...|.:|||     
  Fly   200 HQFEHNGIRPYPCKECPKTFLVASELKAHNLTHHTLEPPFACRYCDRRYFSVVGRKKHERVHTNE 264

  Fly   298 -----EACKKG-------RAPQSKWEIIKKGERTFHCEVCDLWFLRAGNFTQHINSSSHIENERR 350
                 :.|.|.       :|..:..::::|    :.|:|||..|....:...|..|::|      
  Fly   265 RPFVCDQCGKAFTRTCILKAHMAVHQVVRK----YSCDVCDRSFSLKKHLATHFISNTH------ 319

  Fly   351 KKRKSNPTAINS 362
               |.|..|:.|
  Fly   320 ---KRNAEAVTS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071 20/69 (29%)
C2H2 Zn finger 224..244 CDD:275368 6/19 (32%)
C2H2 Zn finger 252..272 CDD:275368 5/19 (26%)
C2H2 Zn finger 279..297 CDD:275368 5/17 (29%)
C2H2 Zn finger 322..339 CDD:275368 5/16 (31%)
nomNP_001262384.1 zf-AD 5..76 CDD:214871 22/95 (23%)
C2H2 Zn finger 184..204 CDD:275368 6/19 (32%)
C2H2 Zn finger 212..261 CDD:275368 16/48 (33%)
zf-H2C2_2 255..278 CDD:290200 5/22 (23%)
C2H2 Zn finger 269..289 CDD:275368 3/19 (16%)
zf-H2C2_2 282..305 CDD:290200 6/26 (23%)
C2H2 Zn finger 297..313 CDD:275368 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.