DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4820 and Blimp-1

DIOPT Version :9

Sequence 1:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster


Alignment Length:334 Identity:74/334 - (22%)
Similarity:121/334 - (36%) Gaps:98/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 NLGEAPAAMEQLRVQQAAAPDPLGIDELMSASDIKIEPIQLQMEEDPQAPYPENQL------EQA 141
            |||:.|   |||    :::...:|..|:..|:.||.|     ....|.:.:..|.:      ...
  Fly   707 NLGQNP---EQL----SSSAVVVGEQEMTRATMIKGE-----CSPPPPSHHHHNVIFSPSRHAAY 759

  Fly   142 LSYGNAPGEDILPLP-----EDYGEAQTEV----ATTTNEPAQRRS--KNTAKIKSKKHTMRVGR 195
            |..|.|.|..  |.|     ..||.|.|..    ..:::.|..|:|  .:.|...:..|.::...
  Fly   760 LGAGEAGGHS--PSPGYPGYPHYGAAATSTFHSPPHSSHSPFDRQSNASSGAGSATNLHLLQTST 822

  Fly   196 KLIH------VKVIDDKQPKRI------------VDRNGPSAKP--------------------- 221
            ::::      :..:....|.||            ..|:|....|                     
  Fly   823 QMLNHPLMQPLTPLQRLSPLRISPPSSLSPDGNSCPRSGSPLSPNSLASRGYRSLPYPLKKKDGK 887

  Fly   222 --CICEHCGRQFKDTSNLHVHLLRHTGTKPFECDQCHQKCYTLHLLRRHQLKHT-EGPYACTFCG 283
              ..|..|.:.|...|||.|||..|:|.:||:|:.|.:....|..|::|.|.|| |.|:.|..|.
  Fly   888 MHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICK 952

  Fly   284 LEYSTNSSRVRHEREACKKGRAPQSKWEIIKKGERTFHCEVCDLWFLRAGNFTQHINSSSHIENE 348
            ..:|:.|:...|.|               :..|::.:.|::|      ...|||.:    |::..
  Fly   953 KRFSSTSNLKTHLR---------------LHSGQKPYACDLC------PQKFTQFV----HLKLH 992

  Fly   349 RRKKRKSNP 357
            :|......|
  Fly   993 KRLHTNDRP 1001

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071
C2H2 Zn finger 224..244 CDD:275368 9/19 (47%)
C2H2 Zn finger 252..272 CDD:275368 6/19 (32%)
C2H2 Zn finger 279..297 CDD:275368 5/17 (29%)
C2H2 Zn finger 322..339 CDD:275368 5/16 (31%)
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 9/19 (47%)
zf-H2C2_2 904..929 CDD:290200 11/24 (46%)
C2H2 Zn finger 920..940 CDD:275368 6/19 (32%)
zf-H2C2_2 932..957 CDD:290200 9/24 (38%)
C2H2 Zn finger 948..968 CDD:275368 6/34 (18%)
zf-H2C2_2 960..985 CDD:290200 6/45 (13%)
C2H2 Zn finger 976..996 CDD:275368 7/29 (24%)
C2H2 Zn finger 1004..1023 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.