DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4820 and scrt

DIOPT Version :9

Sequence 1:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster


Alignment Length:153 Identity:40/153 - (26%)
Similarity:62/153 - (40%) Gaps:32/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LPLPEDY------GEAQTEVATTTNEPAQRRSKNTAKIKSKKHTMRVGR---------------K 196
            :|.|:..      .|...:.||::|....:::..:...:|.|.....|:               |
  Fly   457 VPTPDQQKTKYTCSECGKQYATSSNLSRHKQTHRSLDSQSAKKCHTCGKAYVSMPALAMHLLTHK 521

  Fly   197 LIHVKVIDDK---QPKRIVD--RNGPSAKPCICEHCGRQFKDTSNLHVHLLRHTGTKPFECDQCH 256
            |.|...:..|   :|..:..  |:....||..|.|||:.|.|.|||..|:..|:..|.|||.:||
  Fly   522 LSHSCGVCGKLFSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSVDKNFECKRCH 586

  Fly   257 QKCYTLHLLRRHQLKHTEGPYAC 279
            :    ...|:.:..||.|.  ||
  Fly   587 K----TFALKSYLNKHLES--AC 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071
C2H2 Zn finger 224..244 CDD:275368 10/19 (53%)
C2H2 Zn finger 252..272 CDD:275368 4/19 (21%)
C2H2 Zn finger 279..297 CDD:275368 1/1 (100%)
C2H2 Zn finger 322..339 CDD:275368
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 4/21 (19%)
C2H2 Zn finger 469..489 CDD:275370 4/19 (21%)
C2H2 Zn finger 500..520 CDD:275368 1/19 (5%)
COG5048 520..>617 CDD:227381 31/90 (34%)
C2H2 Zn finger 526..546 CDD:275368 3/19 (16%)
zf-H2C2_2 539..562 CDD:290200 7/22 (32%)
C2H2 Zn finger 554..574 CDD:275368 10/19 (53%)
zf-C2H2 554..574 CDD:278523 10/19 (53%)
zf-H2C2_2 566..590 CDD:290200 10/27 (37%)
C2H2 Zn finger 582..599 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.