DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4820 and CG1529

DIOPT Version :9

Sequence 1:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster


Alignment Length:416 Identity:80/416 - (19%)
Similarity:142/416 - (34%) Gaps:108/416 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FTPAGRKLLQCVRSI----TNC-------WLQNVQDL---------PNHICTDCQVLLSQVQKFR 65
            ||...|....|:|.:    |:|       .||.:.|:         |..||..|...:....:.|
  Fly     5 FTDLARLCRICLRHLRDRDTHCPDPRLIAILQKLLDIDILKQPHGFPTEICNLCHNAVVYFDELR 69

  Fly    66 RRCAKIEKYFARRRRRMNLGEAPAAMEQLRVQQAAAPDPLGIDELMSASDIKIEPIQLQMEEDPQ 130
            :        .||...:..:|..|..:...||::  .|...|:.|....::.::|....:..:..|
  Fly    70 Q--------VARESSQKLIGWQPVDIAVDRVKE--EPPDEGLKENHEENEHELEEEHEKQADGQQ 124

  Fly   131 APYPENQLEQALSYGNAPGEDILPLPEDYGEAQTEVATTTNEPAQRRSKNTAKIKSKKHTMRVGR 195
            ....:.|.:|.....:...|:   .|::|..:|.:::..|   ..:|....|..:..|...::..
  Fly   125 VDLSKKQEDQKKILDDREDEE---YPDEYENSQQQLSQGT---GSKRRAGLACDQCGKQVYKLPY 183

  Fly   196 KLIHVKVIDDKQPKRIVDRNGPSA-------------------------KPCICEHCGRQFKDTS 235
            ...|::.:.....|..:.|:...:                         :..|||.|.||:...:
  Fly   184 LEAHIRSVHQGYSKPFLCRSCDKSFTRYEQLRSHMRNAHPQLEQLQQELRDLICELCNRQYSTKN 248

  Fly   236 NLHVHLLRHTGTKP-----------------------------FECDQCHQKCYTLHLLRRHQLK 271
            .|..||.||...|.                             |:|:||.|.......:.||...
  Fly   249 ALGEHLKRHAQRKEHVCEHCGVAKVTRTELLTHLRTHNPTWERFKCEQCPQLFRHKSAISRHVRV 313

  Fly   272 HTEGP--YACTFCGLEYSTNSSRVRHER---EACKKGRAPQSKWEIIKKGERTFHCE-VCDLWFL 330
            ..||.  :.|..|..::.|::|:|||||   |:...|.|.: :|..     ...||: .|     
  Fly   314 VHEGQRRFQCGHCEKKFGTHASQVRHERLHTESTGSGEAAE-EWPF-----ACIHCQKPC----- 367

  Fly   331 RAGNFTQHINSSSHIENERRKKRKSN 356
             ....|..::...|...:..:||:.:
  Fly   368 -VSRQTLELHLRRHRARKTHRKRREH 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071 15/73 (21%)
C2H2 Zn finger 224..244 CDD:275368 8/19 (42%)
C2H2 Zn finger 252..272 CDD:275368 6/19 (32%)
C2H2 Zn finger 279..297 CDD:275368 7/17 (41%)
C2H2 Zn finger 322..339 CDD:275368 3/17 (18%)
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 14/75 (19%)
C2H2 Zn finger 171..192 CDD:275368 2/20 (10%)
zf-C2H2_2 201..>257 CDD:289522 10/55 (18%)
C2H2 Zn finger 201..222 CDD:275368 1/20 (5%)
C2H2 Zn finger 237..257 CDD:275368 8/19 (42%)
C2H2 Zn finger 265..285 CDD:275368 0/19 (0%)
zf-C2H2_8 268..349 CDD:292531 19/80 (24%)
C2H2 Zn finger 294..315 CDD:275368 6/20 (30%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
C2H2 Zn finger 360..380 CDD:275368 4/25 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.