DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4820 and CG42726

DIOPT Version :9

Sequence 1:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster


Alignment Length:133 Identity:36/133 - (27%)
Similarity:50/133 - (37%) Gaps:24/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 CEHCGRQFKDTSNLHVHLLRHTGTKPFECDQCHQKCYTLHLLRRHQLKHTEGPYACTFCGLEYST 288
            |:.|||:|..:|:|..||:.|.......|..||:......:|:||.|.|.:..:.|..|...:..
  Fly   103 CKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEKHLCPICQKVFRR 167

  Fly   289 NSSRVRHEREACKKGRAPQSKWEIIKKGERTFHCEVCDLWFLRAGNFTQHINSSSHIENERRKKR 353
            .||...|.......|              ..|.||:|...|....|..||:          ||..
  Fly   168 KSSLASHLAIHSDLG--------------LQFKCELCSKHFQNKANLNQHL----------RKHD 208

  Fly   354 KSN 356
            |:|
  Fly   209 KNN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071
C2H2 Zn finger 224..244 CDD:275368 9/19 (47%)
C2H2 Zn finger 252..272 CDD:275368 7/19 (37%)
C2H2 Zn finger 279..297 CDD:275368 5/17 (29%)
C2H2 Zn finger 322..339 CDD:275368 6/16 (38%)
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 9/19 (47%)
COG5048 <112..288 CDD:227381 31/124 (25%)
C2H2 Zn finger 131..151 CDD:275368 7/19 (37%)
Chordopox_A33R 151..>254 CDD:283591 19/85 (22%)
C2H2 Zn finger 158..178 CDD:275368 5/19 (26%)
C2H2 Zn finger 187..207 CDD:275368 8/29 (28%)
C2H2 Zn finger 216..236 CDD:275368
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..290 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457228
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.