DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS25 and RPS25B

DIOPT Version :9

Sequence 1:NP_524315.2 Gene:RpS25 / 41343 FlyBaseID:FBgn0086472 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_013437.1 Gene:RPS25B / 851045 SGDID:S000004325 Length:108 Species:Saccharomyces cerevisiae


Alignment Length:115 Identity:48/115 - (41%)
Similarity:70/115 - (60%) Gaps:7/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKKDAKSSAKQPQKTQKKKEGSGGGKAKKKKWSKGKVRDKLNNQVLFDKATYEKLYKEVPAYK 65
            ||||       :|..|..|......|||..||||||..::|:..:.|:.|:..|:::.||||.|:
Yeast     1 MPPK-------QQLSKAAKAAAALAGGKKSKKKWSKKSMKDRAQHAVILDQEKYDRILKEVPTYR 58

  Fly    66 LITPSVVSERLKIRGSLAKRALIELREKGLIKQVVQHHSQVIYTRATKGD 115
            .::.||:.:||||.||||:.||..|.::|:||.:.:|..|.|||||...:
Yeast    59 YVSVSVLVDRLKIGGSLARIALRHLEKEGIIKPISKHSKQAIYTRAAASE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS25NP_524315.2 Ribosomal_S25 <34..110 CDD:397404 32/75 (43%)
RPS25BNP_013437.1 RPS25 1..107 CDD:227238 48/112 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341441
Domainoid 1 1.000 92 1.000 Domainoid score I1715
eggNOG 1 0.900 - - E1_COG4901
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1481
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53759
OrthoFinder 1 1.000 - - FOG0001329
OrthoInspector 1 1.000 - - otm46965
orthoMCL 1 0.900 - - OOG6_100950
Panther 1 1.100 - - O PTHR12850
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1240
SonicParanoid 1 1.000 - - X824
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.