DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS25 and AT4G34555

DIOPT Version :9

Sequence 1:NP_524315.2 Gene:RpS25 / 41343 FlyBaseID:FBgn0086472 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_567968.1 Gene:AT4G34555 / 829607 AraportID:AT4G34555 Length:108 Species:Arabidopsis thaliana


Alignment Length:114 Identity:68/114 - (59%)
Similarity:83/114 - (72%) Gaps:6/114 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKKDAKSSAKQPQKTQKKKEGSGGGKAKKKKWSKGKVRDKLNNQVLFDKATYEKLYKEVPAYK 65
            |.||||     |.|..:.|..: |||||.|||||||||.::|:||.||||:|||:||..|.|.:|
plant     1 MAPKKD-----KVPPPSSKPAK-SGGGKQKKKKWSKGKQKEKVNNMVLFDQATYDKLLSEAPKFK 59

  Fly    66 LITPSVVSERLKIRGSLAKRALIELREKGLIKQVVQHHSQVIYTRATKG 114
            |||||::|:||:|.||||:||:.||..||.|:.|..|.||.||||||.|
plant    60 LITPSILSDRLRINGSLARRAIRELMAKGTIRMVSAHSSQQIYTRATHG 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS25NP_524315.2 Ribosomal_S25 <34..110 CDD:397404 46/75 (61%)
AT4G34555NP_567968.1 Ribosomal_S25 5..104 CDD:397404 60/104 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 122 1.000 Domainoid score I1844
eggNOG 1 0.900 - - E1_COG4901
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I1881
OMA 1 1.010 - - QHG53759
OrthoDB 1 1.010 - - D1552294at2759
OrthoFinder 1 1.000 - - FOG0001329
OrthoInspector 1 1.000 - - otm3277
orthoMCL 1 0.900 - - OOG6_100950
Panther 1 1.100 - - LDO PTHR12850
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X824
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.