DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS25 and AT2G16360

DIOPT Version :9

Sequence 1:NP_524315.2 Gene:RpS25 / 41343 FlyBaseID:FBgn0086472 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001318230.1 Gene:AT2G16360 / 816132 AraportID:AT2G16360 Length:109 Species:Arabidopsis thaliana


Alignment Length:110 Identity:63/110 - (57%)
Similarity:80/110 - (72%) Gaps:6/110 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PKKDAKSSAKQPQKTQKKKEGSGGGKAKKKKWSKGKVRDKLNNQVLFDKATYEKLYKEVPAYKLI 67
            ||||     |.|..:.|..: |||||.|||||||||.::|:||.||||:|||:||..|.|.:|||
plant     3 PKKD-----KVPPPSSKPAK-SGGGKQKKKKWSKGKQKEKVNNMVLFDQATYDKLMSEAPKFKLI 61

  Fly    68 TPSVVSERLKIRGSLAKRALIELREKGLIKQVVQHHSQVIYTRAT 112
            |||::|:||:|.||||::|:.:|..||.|:.|..|.||.|.||||
plant    62 TPSILSDRLRINGSLARKAIRDLMVKGTIRMVSTHSSQQINTRAT 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS25NP_524315.2 Ribosomal_S25 <34..110 CDD:397404 43/75 (57%)
AT2G16360NP_001318230.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 122 1.000 Domainoid score I1844
eggNOG 1 0.900 - - E1_COG4901
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I1881
OMA 1 1.010 - - QHG53759
OrthoDB 1 1.010 - - D1552294at2759
OrthoFinder 1 1.000 - - FOG0001329
OrthoInspector 1 1.000 - - otm3277
orthoMCL 1 0.900 - - OOG6_100950
Panther 1 1.100 - - O PTHR12850
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X824
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.