DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS25 and Rps25

DIOPT Version :10

Sequence 1:NP_524315.2 Gene:RpS25 / 41343 FlyBaseID:FBgn0086472 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_077228.1 Gene:Rps25 / 75617 MGIID:1922867 Length:125 Species:Mus musculus


Alignment Length:45 Identity:14/45 - (31%)
Similarity:19/45 - (42%) Gaps:1/45 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FQSIHVYLPERSTKVTFADEEMSRLRSDTFIKPGSESSFDSEDLN 53
            |...||..|..:.:|..|..| |.:...|.:.||..|:...|..|
Mouse    78 FFDSHVPTPASTAQVDVAQPE-SPVTPVTPVTPGFTSTSPDETSN 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS25NP_524315.2 Ribosomal_S25 <34..110 CDD:460876 6/20 (30%)
Rps25NP_077228.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
Ribosomal_S25 19..111 CDD:460876 10/33 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.