DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS25 and LOC685085

DIOPT Version :9

Sequence 1:NP_524315.2 Gene:RpS25 / 41343 FlyBaseID:FBgn0086472 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_038964660.1 Gene:LOC685085 / 685085 RGDID:1583218 Length:125 Species:Rattus norvegicus


Alignment Length:114 Identity:81/114 - (71%)
Similarity:89/114 - (78%) Gaps:4/114 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKDAKSSAKQPQKTQKKKEGSGGGKAKKKKWSKGKVRDKLNNQVLFDKATYEKLYKEVPAYKLIT 68
            ||||..|||:    .|......||||||||||||||||||||.:|||||||:||.||||.|||||
  Rat     9 KKDAGKSAKK----DKDPVNKSGGKAKKKKWSKGKVRDKLNNLILFDKATYDKLCKEVPNYKLIT 69

  Fly    69 PSVVSERLKIRGSLAKRALIELREKGLIKQVVQHHSQVIYTRATKGDEA 117
            |:|||||||||||||:.||.||..|||||.|.:|.:||||||.|||.:|
  Rat    70 PAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDA 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS25NP_524315.2 Ribosomal_S25 <34..110 CDD:397404 59/75 (79%)
LOC685085XP_038964660.1 Ribosomal_S25 19..111 CDD:397404 68/91 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.