DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS25 and rps25

DIOPT Version :9

Sequence 1:NP_524315.2 Gene:RpS25 / 41343 FlyBaseID:FBgn0086472 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001005084.1 Gene:rps25 / 448660 XenbaseID:XB-GENE-921807 Length:125 Species:Xenopus tropicalis


Alignment Length:118 Identity:83/118 - (70%)
Similarity:90/118 - (76%) Gaps:1/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKKD-AKSSAKQPQKTQKKKEGSGGGKAKKKKWSKGKVRDKLNNQVLFDKATYEKLYKEVPAY 64
            ||||.| .|..|.:..|..|......||||||||||||||||||||.||||||||:||.||||.|
 Frog     1 MPPKDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNY 65

  Fly    65 KLITPSVVSERLKIRGSLAKRALIELREKGLIKQVVQHHSQVIYTRATKGDEA 117
            |||||:|||||||||||||:.||.||..|||||.|.:|.:||||||.|||.:|
 Frog    66 KLITPAVVSERLKIRGSLARAALQELLNKGLIKLVSKHRAQVIYTRNTKGGDA 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS25NP_524315.2 Ribosomal_S25 <34..110 CDD:397404 60/75 (80%)
rps25NP_001005084.1 Ribosomal_S25 19..111 CDD:397404 69/91 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4770
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4211
OMA 1 1.010 - - QHG53759
OrthoDB 1 1.010 - - D1552294at2759
OrthoFinder 1 1.000 - - FOG0001329
OrthoInspector 1 1.000 - - oto105547
Panther 1 1.100 - - LDO PTHR12850
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1240
SonicParanoid 1 1.000 - - X824
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.