DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS25 and rps25

DIOPT Version :9

Sequence 1:NP_524315.2 Gene:RpS25 / 41343 FlyBaseID:FBgn0086472 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_957109.1 Gene:rps25 / 393788 ZFINID:ZDB-GENE-040426-1788 Length:124 Species:Danio rerio


Alignment Length:120 Identity:87/120 - (72%)
Similarity:96/120 - (80%) Gaps:5/120 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKKDAKSSAKQPQKTQKKKE--GSGGGKAKKKKWSKGKVRDKLNNQVLFDKATYEKLYKEVPA 63
            ||| ||:|.. |...|::|.|:  ...||||||||||||||||||||.||||||||:|||||||.
Zfish     1 MPP-KDSKQK-KDAGKSKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLYKEVPN 63

  Fly    64 YKLITPSVVSERLKIRGSLAKRALIELREKGLIKQVVQHHSQVIYTRATKG-DEA 117
            ||||||:|||||||||||||:.||.||..|||||.|.:|.:||||||.||| |||
Zfish    64 YKLITPAVVSERLKIRGSLARAALQELLGKGLIKLVSKHRAQVIYTRNTKGTDEA 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS25NP_524315.2 Ribosomal_S25 <34..110 CDD:397404 61/75 (81%)
rps25NP_957109.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37 20/37 (54%)
Ribosomal_S25 12..111 CDD:281313 73/98 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574189
Domainoid 1 1.000 141 1.000 Domainoid score I4677
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133893
Inparanoid 1 1.050 155 1.000 Inparanoid score I4273
OMA 1 1.010 - - QHG53759
OrthoDB 1 1.010 - - D1552294at2759
OrthoFinder 1 1.000 - - FOG0001329
OrthoInspector 1 1.000 - - oto39228
orthoMCL 1 0.900 - - OOG6_100950
Panther 1 1.100 - - LDO PTHR12850
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1240
SonicParanoid 1 1.000 - - X824
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.900

Return to query results.
Submit another query.