DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS25 and Rps25l2

DIOPT Version :10

Sequence 1:NP_524315.2 Gene:RpS25 / 41343 FlyBaseID:FBgn0086472 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_038934114.1 Gene:Rps25l2 / 366605 RGDID:1563613 Length:124 Species:Rattus norvegicus


Alignment Length:119 Identity:80/119 - (67%)
Similarity:86/119 - (72%) Gaps:7/119 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKKDAKSSAKQPQKTQKKKE---GSGGGKAKKKKWSKGKVRDKLNNQVLFDKATYEKLYKEVP 62
            ||||.|.|.  |...|:.||.:   ...|||| |||||||||.|||||.||||||||:||.||||
  Rat     1 MPPKDDKKK--KDAGKSAKKDKDPINKSGGKA-KKKWSKGKVLDKLNNLVLFDKATYDKLCKEVP 62

  Fly    63 AYKLITPSVVSERLKIRGSLAKRALIELREKGLIKQVVQHHSQVIYTRATK-GD 115
            .||||||.||||||||.|||.:.||.||..|||||.|.:|.:||||||.|| ||
  Rat    63 NYKLITPCVVSERLKILGSLVRAALQELLSKGLIKLVSKHRAQVIYTRNTKVGD 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS25NP_524315.2 Ribosomal_S25 <34..110 CDD:460876 57/75 (76%)
Rps25l2XP_038934114.1 Ribosomal_S25 <41..110 CDD:460876 51/68 (75%)

Return to query results.
Submit another query.