DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS25 and rps2501

DIOPT Version :9

Sequence 1:NP_524315.2 Gene:RpS25 / 41343 FlyBaseID:FBgn0086472 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_595515.1 Gene:rps2501 / 2540965 PomBaseID:SPBC3D6.15 Length:88 Species:Schizosaccharomyces pombe


Alignment Length:83 Identity:45/83 - (54%)
Similarity:64/83 - (77%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AKKKKWSKGKVRDKLNNQVLFDKATYEKLYKEVPAYKLITPSVVSERLKIRGSLAKRALIELREK 93
            |.|||||||||:||..:..:|||:..:::.|||||:|.|:.||:.:|:||.||||:.|:.:|.|:
pombe     2 APKKKWSKGKVKDKAQHATVFDKSIIDRINKEVPAFKFISVSVLVDRMKINGSLARIAIRDLAER 66

  Fly    94 GLIKQVVQHHSQVIYTRA 111
            |:|::|.||..|.|||||
pombe    67 GVIQKVDQHSKQAIYTRA 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS25NP_524315.2 Ribosomal_S25 <34..110 CDD:397404 38/75 (51%)
rps2501NP_595515.1 Ribosomal_S25 <10..84 CDD:281313 36/73 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 94 1.000 Domainoid score I1954
eggNOG 1 0.900 - - E1_COG4901
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I1703
OMA 1 1.010 - - QHG53759
OrthoFinder 1 1.000 - - FOG0001329
OrthoInspector 1 1.000 - - otm47416
orthoMCL 1 0.900 - - OOG6_100950
Panther 1 1.100 - - LDO PTHR12850
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1240
SonicParanoid 1 1.000 - - X824
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.