DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS25 and rps-25

DIOPT Version :9

Sequence 1:NP_524315.2 Gene:RpS25 / 41343 FlyBaseID:FBgn0086472 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_500895.1 Gene:rps-25 / 177365 WormBaseID:WBGene00004494 Length:117 Species:Caenorhabditis elegans


Alignment Length:113 Identity:86/113 - (76%)
Similarity:92/113 - (81%) Gaps:3/113 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKKDAKSSAKQPQKTQKKKEGSGGGKAKKKKWSKGKVRDKLNNQVLFDKATYEKLYKEVPAYK 65
            ||||||.|.....|   .|||||||||||||||||||||||||||.||||:|||:||||||..||
 Worm     1 MPPKKDPKGGKAPP---SKKKEGSGGGKAKKKKWSKGKVRDKLNNMVLFDQATYDKLYKEVITYK 62

  Fly    66 LITPSVVSERLKIRGSLAKRALIELREKGLIKQVVQHHSQVIYTRATK 113
            ||||||||||||:|.||||..|.||:.|||:|.||.||.||:||||||
 Worm    63 LITPSVVSERLKVRASLAKAGLKELQAKGLVKCVVHHHGQVVYTRATK 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS25NP_524315.2 Ribosomal_S25 <34..110 CDD:397404 58/75 (77%)
rps-25NP_500895.1 Ribosomal_S25 <31..108 CDD:281313 59/76 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156335
Domainoid 1 1.000 154 1.000 Domainoid score I2613
eggNOG 1 0.900 - - E1_COG4901
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133893
Inparanoid 1 1.050 169 1.000 Inparanoid score I2766
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53759
OrthoDB 1 1.010 - - D1552294at2759
OrthoFinder 1 1.000 - - FOG0001329
OrthoInspector 1 1.000 - - oto20264
orthoMCL 1 0.900 - - OOG6_100950
Panther 1 1.100 - - LDO PTHR12850
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1240
SonicParanoid 1 1.000 - - X824
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.