DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT86D and AT1G33020

DIOPT Version :10

Sequence 1:NP_650049.1 Gene:ZnT86D / 41342 FlyBaseID:FBgn0037875 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_174578.1 Gene:AT1G33020 / 840197 AraportID:AT1G33020 Length:548 Species:Arabidopsis thaliana


Alignment Length:32 Identity:10/32 - (31%)
Similarity:16/32 - (50%) Gaps:4/32 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 VYAVQEPHFWTLCSDVYVGALKLEVSKNVDPK 341
            |.||.|.|.|:    :.||.:.|....::.|:
plant   492 VTAVHELHIWS----ITVGKVSLASQVSIKPE 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT86DNP_650049.1 CzcD 45..365 CDD:440843 10/32 (31%)
AT1G33020NP_174578.1 F-box 7..49 CDD:425796
F_box_assoc_1 110..338 CDD:273726
CzcD <492..543 CDD:440843 10/32 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.