DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT86D and SLC30A3

DIOPT Version :9

Sequence 1:NP_650049.1 Gene:ZnT86D / 41342 FlyBaseID:FBgn0037875 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_005264604.1 Gene:SLC30A3 / 7781 HGNCID:11014 Length:412 Species:Homo sapiens


Alignment Length:67 Identity:15/67 - (22%)
Similarity:35/67 - (52%) Gaps:2/67 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LFLLLNLSFAFV--ELFYGIVTNSLGLISDSFHMFFDCTGLLAGLAASVITKWKANDKFSYGYVR 100
            |:....:.|.|:  |:..|.:.:||.:::|:.|:..|...::..|.:..::...|....::|:.|
Human    76 LYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHR 140

  Fly   101 AE 102
            :|
Human   141 SE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT86DNP_650049.1 CDF 46..366 CDD:273544 14/59 (24%)
Cation_efflux 46..286 CDD:279834 14/59 (24%)
SLC30A3XP_005264604.1 Cation_efflux 85..>142 CDD:279834 12/56 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.