DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT86D and slc30a6

DIOPT Version :9

Sequence 1:NP_650049.1 Gene:ZnT86D / 41342 FlyBaseID:FBgn0037875 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_991214.1 Gene:slc30a6 / 402949 ZFINID:ZDB-GENE-040426-1838 Length:486 Species:Danio rerio


Alignment Length:348 Identity:85/348 - (24%)
Similarity:152/348 - (43%) Gaps:42/348 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PLSHKDRSSLGYRIREKLNSWKRLIFSDRNSRNLFLFLLLNLSFAFVELFYGIVTNSLGLISDSF 67
            |.....||.||     ||....||:.|||.|..:.||.:||:......|.:...|||:.|.:.::
Zfish    33 PFRKAHRSVLG-----KLAQEFRLVTSDRRSWKILLFGVLNVVCTGCLLMWCSSTNSMALTAYTY 92

  Fly    68 HMFFDCTGLLAGLAASVITKWKANDKFSYGYVRAEVLAGFVNSLFLLFIAFFILSEGVERLIEPP 132
            ...||...|:..|.:..:|..|.:..:|:|:.|.||||.|.:::.:...:.|||.|.|||.:|.|
Zfish    93 LTIFDLFSLITCLLSLWVTMKKPSQIYSFGFQRFEVLAVFSSTVLVQLGSLFILKESVERFVEQP 157

  Fly   133 EVKHERLFVVSVLGLLVNLVGIYAFNHGGHGHSHGGHGHSHGGGHGHGHSHGHTDAGNHNHQAIT 197
            ||...||.|.:.:.|..||:.:.:..                                 |...:.
Zfish   158 EVHTGRLLVGTFVALFFNLLTLLSVK---------------------------------NKPFVF 189

  Fly   198 LDNGHGHS----HDHDSHGHSHGDMSGSNSQIMRGVFLHILADTLGSVGVIISAVLMHMFGWMIA 258
            :......|    |..|......|.:...:|.::..:...:|.:..|:..:.|:.:|:.:..:...
Zfish   190 VSEAASTSWLQEHVADLSRSLCGLIPALSSFLLPRMNPFVLINLAGAFALGITYMLIEINNYNAM 254

  Fly   259 DPICSIFIALLIALSVLSLIKESIMILMQRQPADLDRSLPQCYQKVTGLAGVYAVQEPHFWTLCS 323
            |...::.|||:...::..:...|..:|:|..|:.:...|.:..::|:.|.||..|:..||||:..
Zfish   255 DTASAVAIALMTFGTMYPMSVYSGKVLLQTTPSHVIGQLDKLLREVSTLDGVLEVRNEHFWTIGF 319

  Fly   324 DVYVGALKLEVSKNVDPKYVVTH 346
            ....|::.:.:.::.|.:.|:.|
Zfish   320 GSLAGSVHVRIRRDADEQMVLAH 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT86DNP_650049.1 CDF 46..366 CDD:273544 68/305 (22%)
Cation_efflux 46..286 CDD:279834 51/243 (21%)
slc30a6NP_991214.1 Cation_efflux 70..282 CDD:279834 51/244 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 394..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.