DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT86D and ZnT35C

DIOPT Version :9

Sequence 1:NP_650049.1 Gene:ZnT86D / 41342 FlyBaseID:FBgn0037875 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_609741.3 Gene:ZnT35C / 34890 FlyBaseID:FBgn0028516 Length:472 Species:Drosophila melanogaster


Alignment Length:373 Identity:93/373 - (24%)
Similarity:169/373 - (45%) Gaps:69/373 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RNLFLFLLLNLSFAFVELFYGIVTNSLGLISDSFHMFFDCTGLLAGLAASVITKWKANDKFSYGY 98
            |.|.:..:|.|.|...|:..|:::|||.:.:|:.|:..|....:..|.|..|....:..:.|:|:
  Fly    89 RKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFMISLFAIWIAGRPSTQRMSFGW 153

  Fly    99 VRAEVLAGFVNSLFLLFIAFFILS-EGVERLIEPP-EVKHERLFVVSVLGLLVNLV-GIYAFNHG 160
            .||||: |.:.|:|::::...||. ..:.|||... ||..:.:.:.|.|.:|||:: |:..    
  Fly   154 YRAEVI-GAMASVFMIWVITGILVWLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQL---- 213

  Fly   161 GHGHSHGGHGHSHGGGHGHGHSHGHTDAGNHNHQAIT---------LDNGHGHS-HDHDSHG--- 212
                   .||||||.|.|||||||.:...:|.....|         ::.|..:: .|.:..|   
  Fly   214 -------QHGHSHGLGGGHGHSHGGSKNASHVQATSTPCSDSPSQRIEGGVAYAPEDAELPGGGL 271

  Fly   213 ------------------------------HSHGDMSGSNSQIM--RGVFLHILADTLGSVGVII 245
                                          |.||...|..:..|  |...:|::.|.:.||||.:
  Fly   272 PTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREAVNMNVRAALIHVIGDVIQSVGVFV 336

  Fly   246 SAVLMHMF-GWMIADPICSIFIALLIALSVLSLIKESIMILMQRQPADLDRSLPQCYQKVTGLAG 309
            :|.:::.: .:.|.||||:...::::..:..:::|:::::||:..|..:..:  :..|...|:.|
  Fly   337 AAGVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLVLMEGTPNYMHYA--EVLQIFQGIEG 399

  Fly   310 VYAVQEPHFWTLCSDVYVGALKLEVSKNVDPKYVV------THTRMIF 351
            |..|.....|.|..:....:..|.:::|.:||.::      .|.|..|
  Fly   400 VERVHNLRIWALSINKVALSAHLAIAENANPKRILDAATSAVHLRYNF 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT86DNP_650049.1 CDF 46..366 CDD:273544 89/361 (25%)
Cation_efflux 46..286 CDD:279834 72/288 (25%)
ZnT35CNP_609741.3 CDF 100..457 CDD:273544 89/362 (25%)
Cation_efflux 100..378 CDD:279834 72/289 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457002
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.