DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT86D and Slc30a8

DIOPT Version :9

Sequence 1:NP_650049.1 Gene:ZnT86D / 41342 FlyBaseID:FBgn0037875 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_008763722.1 Gene:Slc30a8 / 299903 RGDID:1308282 Length:369 Species:Rattus norvegicus


Alignment Length:347 Identity:75/347 - (21%)
Similarity:145/347 - (41%) Gaps:75/347 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HKDRSSLGYRIREKLNSWKRLIFSDRNSRNLFLFLLLNLSFAFVELFYGIVTNSLGLISDSFHMF 70
            |....:.|.|..:::::..||..:   |...|.|::       .|:..|.|..||.:::|:.|:.
  Rat    54 HNSFKATGNRSSKQVHAKWRLCAA---SAICFFFMV-------AEVVGGHVAGSLAVLTDAAHLL 108

  Fly    71 FDCTGLLAGLAASVITKWKANDKFSYGYVRAEVLAGFVNSLFLLFIAFFILSEGVERLIEPP-EV 134
            .|.|..|..|.:..::....:.:.::|:.|||:|...::.|.:..:...::....|||:.|. ::
  Rat   109 IDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLVYLACERLLYPDYQI 173

  Fly   135 KHERLFVVSVLGLLVNLVGIYAFNHGGHGHSHGGHGHSHGGGHGHGHSHGHTDAGNHNHQAITLD 199
            :...:..||...:..|:|                                           :||.
  Rat   174 QAGIMITVSGCAVAANIV-------------------------------------------LTLI 195

  Fly   200 NGHGHSHDHDSH-GHSHGDMSGSNSQIMRGVFLHILADTLGSVGVIISAVLMHMF-GWMIADPIC 262
            .       |..| ||:|.|...:.|  :|..|:|.|.|...|..|:|||::::.. .:.:|||:|
  Rat   196 L-------HQRHLGHNHKDAQANAS--VRAAFVHALGDVFQSTSVLISALIIYFKPDYKMADPVC 251

  Fly   263 SIFIALLIALSVLSLIKESIMILMQRQPADLDRSLPQCYQKVTGLA----GVYAVQEPHFWTLCS 323
            :...::|...|.:.::|:..::||:..|..|.      |..|..|.    ||.:|...|.|:|..
  Rat   252 TFISSVLALASTVMILKDFSILLMEGVPKGLS------YNSVKELLLTVDGVISVHNLHIWSLTV 310

  Fly   324 DVYVGALKLEVSKNVDPKYVVT 345
            :..:.::.:..:.:.|.:.|.|
  Rat   311 NQVILSVHVATAASQDSQSVRT 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT86DNP_650049.1 CDF 46..366 CDD:273544 67/307 (22%)
Cation_efflux 46..286 CDD:279834 51/242 (21%)
Slc30a8XP_008763722.1 CDF 83..354 CDD:273544 68/315 (22%)
Cation_efflux 84..274 CDD:279834 52/248 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.