DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT86D and Slc30a6

DIOPT Version :9

Sequence 1:NP_650049.1 Gene:ZnT86D / 41342 FlyBaseID:FBgn0037875 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001264208.1 Gene:Slc30a6 / 298786 RGDID:1309250 Length:460 Species:Rattus norvegicus


Alignment Length:346 Identity:83/346 - (23%)
Similarity:150/346 - (43%) Gaps:50/346 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RSSLGYRIREKLNSWKRLIFSDRNSRNLFLFLLLNLSFAFVELFYGIVTNSLGLISDSFHMFFDC 73
            ||..|..::|     .||:.:||.|..:.||..:|:......|.:...|||:.|.:.::...||.
  Rat    12 RSFFGKLLQE-----FRLVAADRRSWKILLFGAINVLCTGFLLMWCSSTNSIALTAYTYLTIFDL 71

  Fly    74 TGLLAGLAASVITKWKANDKFSYGYVRAEVLAGFVNSLFLLFIAFFILSEGVERLIEPPEVKHER 138
            ..|:..|.:..:...:.:..:|:|:.|.||||.|.:::.....|.|||.|..||.:|.||:...|
  Rat    72 FSLITCLISYWVMMRRPSAAYSFGFERLEVLAVFASTVLAQLGALFILKESAERFLEQPEIHTGR 136

  Fly   139 LFVVSVLGLLVNLVGIYAFNHGGHGHSHGGHGHSHGGGHGHGHSHGHTDAGNHNHQAITLDNGHG 203
            |.|.:.:.|..||..:.:..:....:.                |...:.:....|.|        
  Rat   137 LLVGTFVALSFNLFTMLSIRNKPFAYV----------------SEAASTSWLQEHVA-------- 177

  Fly   204 HSHDHDSHGHSHGDMSGSNSQIMRG---VFL-----HILADTLGSVGVIISAVLMHMFGWMIADP 260
                         |:|.|...|:.|   :||     .:|.|..|::.:.|:.:|:.:..:...|.
  Rat   178 -------------DLSRSLCGIIPGLSSIFLPRMNPFVLIDLAGALALCITYMLIEINNYFAVDT 229

  Fly   261 ICSIFIALLIALSVLSLIKESIMILMQRQPADLDRSLPQCYQKVTGLAGVYAVQEPHFWTLCSDV 325
            ..:|.|||:...::..:...|..:|:|..|..:...|.:..::|:.|.||..|:..|||||....
  Rat   230 ASAIAIALMTFGTMYPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGS 294

  Fly   326 YVGALKLEVSKNVDPKYVVTH 346
            ..|::.:.:.::.:.:.|:.|
  Rat   295 LAGSVHVRIRRDANEQMVLAH 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT86DNP_650049.1 CDF 46..366 CDD:273544 71/309 (23%)
Cation_efflux 46..286 CDD:279834 54/247 (22%)
Slc30a6NP_001264208.1 Cation_efflux 43..255 CDD:279834 54/248 (22%)
CzcD 55..331 CDD:224151 70/298 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.