DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhC and SHH3

DIOPT Version :9

Sequence 1:NP_001262472.1 Gene:SdhC / 41340 FlyBaseID:FBgn0037873 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_013836.1 Gene:SHH3 / 855145 SGDID:S000004724 Length:196 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:47/147 - (31%)
Similarity:69/147 - (46%) Gaps:27/147 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TQKDESFFEKNERLGRELSPHLTIYQPQLTSMLSICHRGTG--LALGVGVWGLGLGALISSHDIS 99
            :.|:|... .::|..|.:|||||:|:|:::..||..||.:|  ||||...:.:.||         
Yeast    59 SNKEEELL-VSQRKKRPISPHLTVYEPEMSWYLSSLHRISGVLLALGFYAFTITLG--------- 113

  Fly   100 HYVTMVEGLQLSGATLT-------------ALKFIIAYPAGYHTANGIRHLLWDTGRFLKIKEVY 151
              ||.:.|:..:...|.             ..|...||...:|..||||||:||.|..|..:.|.
Yeast   114 --VTTIMGMDTTFQDLNKWYHEKMPKWSQWVAKGSAAYLFAFHFGNGIRHLIWDMGYELTNRGVI 176

  Fly   152 STGYAMVATSFVLSAIL 168
            .||..::|.:.||...|
Yeast   177 KTGSIVLAGTLVLGTYL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhCNP_001262472.1 SQR_TypeC_SdhC 52..170 CDD:239579 44/132 (33%)
SHH3NP_013836.1 SQR_TypeC_SdhC 73..195 CDD:239579 44/132 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345185
Domainoid 1 1.000 75 1.000 Domainoid score I2134
eggNOG 1 0.900 - - E1_COG2009
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1634
Isobase 1 0.950 - 0.834419 Normalized mean entropy S2419
OMA 1 1.010 - - QHG51899
OrthoFinder 1 1.000 - - FOG0004205
OrthoInspector 1 1.000 - - mtm9202
orthoMCL 1 0.900 - - OOG6_103173
Panther 1 1.100 - - O PTHR10978
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2280
SonicParanoid 1 1.000 - - X2951
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.