DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhC and Sdhc

DIOPT Version :9

Sequence 1:NP_001262472.1 Gene:SdhC / 41340 FlyBaseID:FBgn0037873 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_079597.2 Gene:Sdhc / 66052 MGIID:1913302 Length:169 Species:Mus musculus


Alignment Length:137 Identity:60/137 - (43%)
Similarity:84/137 - (61%) Gaps:2/137 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TQKD--ESFFEKNERLGRELSPHLTIYQPQLTSMLSICHRGTGLALGVGVWGLGLGALISSHDIS 99
            |.|:  |.|::||....|.||||||||:..|...||:||||:|:||..||...||.||:...:..
Mouse    33 TAKEEMERFWKKNTSSNRPLSPHLTIYKWSLPMALSVCHRGSGIALSGGVSLFGLSALLLPGNFE 97

  Fly   100 HYVTMVEGLQLSGATLTALKFIIAYPAGYHTANGIRHLLWDTGRFLKIKEVYSTGYAMVATSFVL 164
            .|:..|:.|.|....:.:.||::.:|..||:.|||||||||.|:.|.|.:|:.:|.|:|..:.:.
Mouse    98 SYLMFVKSLCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLGKGLAIPQVWLSGVAVVVLAVLS 162

  Fly   165 SAILALL 171
            |..||.|
Mouse   163 SGGLAAL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhCNP_001262472.1 SQR_TypeC_SdhC 52..170 CDD:239579 52/117 (44%)
SdhcNP_079597.2 SQR_TypeC_SdhC 50..152 CDD:239579 47/101 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845472
Domainoid 1 1.000 102 1.000 Domainoid score I6877
eggNOG 1 0.900 - - E1_COG2009
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2256
Inparanoid 1 1.050 112 1.000 Inparanoid score I4851
Isobase 1 0.950 - 0.834419 Normalized mean entropy S2419
OMA 1 1.010 - - QHG51899
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004205
OrthoInspector 1 1.000 - - otm42884
orthoMCL 1 0.900 - - OOG6_103173
Panther 1 1.100 - - LDO PTHR10978
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2280
SonicParanoid 1 1.000 - - X2951
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.