DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhC and sdhc

DIOPT Version :9

Sequence 1:NP_001262472.1 Gene:SdhC / 41340 FlyBaseID:FBgn0037873 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001136371.1 Gene:sdhc / 496650 XenbaseID:XB-GENE-974948 Length:169 Species:Xenopus tropicalis


Alignment Length:168 Identity:68/168 - (40%)
Similarity:100/168 - (59%) Gaps:2/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSLIRSPALRQGLQMAAASRPVSMKVVSVAET--QKDESFFEKNERLGRELSPHLTIYQPQLTSM 68
            ::|:...|.||.|:........:..||.:..|  |:.:.|:.||.||.|.||||:|||:..|...
 Frog     2 AALLLRHAGRQCLRTQLTPLLCTRHVVPMGTTAQQEMDRFWNKNTRLNRPLSPHITIYKWSLPMA 66

  Fly    69 LSICHRGTGLALGVGVWGLGLGALISSHDISHYVTMVEGLQLSGATLTALKFIIAYPAGYHTANG 133
            :||.|||||:|:..||...||.||:...|.:.|:.:|:.|.|..|.:.:.||.:|:|..||..||
 Frog    67 MSISHRGTGIAMTAGVSLFGLAALVLPGDFASYLELVKSLSLGPALIYSAKFALAFPLTYHVWNG 131

  Fly   134 IRHLLWDTGRFLKIKEVYSTGYAMVATSFVLSAILALL 171
            ||||.||.|:.|||.:||.:|..::|.:.:.:|.||.:
 Frog   132 IRHLTWDLGKGLKIPQVYRSGVTVLALTLITTATLAAM 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhCNP_001262472.1 SQR_TypeC_SdhC 52..170 CDD:239579 53/117 (45%)
sdhcNP_001136371.1 SQR_TypeC_SdhC 50..168 CDD:239579 53/117 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6316
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2256
Inparanoid 1 1.050 123 1.000 Inparanoid score I4587
OMA 1 1.010 - - QHG51899
OrthoDB 1 1.010 - - D1443173at2759
OrthoFinder 1 1.000 - - FOG0004205
OrthoInspector 1 1.000 - - oto105332
Panther 1 1.100 - - LDO PTHR10978
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2280
SonicParanoid 1 1.000 - - X2951
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.