DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhC and SDH3-2

DIOPT Version :9

Sequence 1:NP_001262472.1 Gene:SdhC / 41340 FlyBaseID:FBgn0037873 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_194948.2 Gene:SDH3-2 / 3770570 AraportID:AT4G32210 Length:213 Species:Arabidopsis thaliana


Alignment Length:117 Identity:38/117 - (32%)
Similarity:56/117 - (47%) Gaps:18/117 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VSMKVVSVAETQKDESFFEKNERLGRELSPHLTIYQPQLTSMLSICHRGTGLAL-GVGVWG---- 86
            :|..:.:..|..|.:||        |.|||||::||||:.|||||.:|.:|:.| ||...|    
plant   108 ISGDIKTTQEEPKIKSF--------RPLSPHLSVYQPQMNSMLSIFNRISGVYLTGVTFAGYLLY 164

  Fly    87 LGLGALISSHDISHYVTMVEGLQLSGATLTALKFIIAYPAGYHTANGIRHLL 138
            |.:|.:..:     |.:..:.|..:...|..:..:.|..|.|||......||
plant   165 LKMGMICLT-----YPSFYQVLYHTQQQLPVITSVTALAAIYHTIKSTHSLL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhCNP_001262472.1 SQR_TypeC_SdhC 52..170 CDD:239579 33/92 (36%)
SDH3-2NP_194948.2 SQR_QFR_TM 1..213 CDD:412626 38/117 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 41 1.000 Domainoid score I4814
eggNOG 1 0.900 - - E1_COG2009
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10978
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.