DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhC and mev-1

DIOPT Version :9

Sequence 1:NP_001262472.1 Gene:SdhC / 41340 FlyBaseID:FBgn0037873 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001366681.1 Gene:mev-1 / 260040 WormBaseID:WBGene00003225 Length:182 Species:Caenorhabditis elegans


Alignment Length:156 Identity:52/156 - (33%)
Similarity:80/156 - (51%) Gaps:10/156 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AAASRPVSMKVVSVAETQKDESFFE-----KNERLGRELSPHLTIYQPQLTSMLSICHRGTGLAL 80
            ::.||.....:|:.:|.:.....|.     |.....|.::||||:||||||.|||..||.:|..:
 Worm    16 SSISRSFGTSIVTKSEAKTPIQKFGWEYLLKQRSKNRPIAPHLTVYQPQLTWMLSGFHRISGCVM 80

  Fly    81 GVGVWGLGLGALISSHDISHYVTMVEGLQLSGATLTALKFIIAYPAGYHTANGIRHLLWDTGRFL 145
            ...:...|:|..:...|.:.:|..:....|..|.....|:|||:|..:||.||||.|.:|..:.:
 Worm    81 AGTLLVGGIGFAVLPFDFTAFVDFIRSWNLPCAVTAVFKYIIAFPIIFHTLNGIRFLGFDLAKGV 145

  Fly   146 -KIKEVYSTGYAMVATSFVLSAILAL 170
             .:.::|.:||.:..    |||||||
 Worm   146 NNVGQIYKSGYLVSG----LSAILAL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhCNP_001262472.1 SQR_TypeC_SdhC 52..170 CDD:239579 44/118 (37%)
mev-1NP_001366681.1 SQR_TypeC_SdhC 52..171 CDD:239579 46/120 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163625
Domainoid 1 1.000 77 1.000 Domainoid score I5743
eggNOG 1 0.900 - - E1_COG2009
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I3807
Isobase 1 0.950 - 0.834419 Normalized mean entropy S2419
OMA 1 1.010 - - QHG51899
OrthoDB 1 1.010 - - D1443173at2759
OrthoFinder 1 1.000 - - FOG0004205
OrthoInspector 1 1.000 - - otm14586
orthoMCL 1 0.900 - - OOG6_103173
Panther 1 1.100 - - LDO PTHR10978
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2280
SonicParanoid 1 1.000 - - X2951
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.