DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cu and ANGEL2

DIOPT Version :9

Sequence 1:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_653168.2 Gene:ANGEL2 / 90806 HGNCID:30534 Length:544 Species:Homo sapiens


Alignment Length:466 Identity:112/466 - (24%)
Similarity:173/466 - (37%) Gaps:122/466 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PSGLSTPALL---QHVQQLRGGGIEQPSLLTR---GFLK---PLLADEDVADGLRCLKLNSVSRV 301
            |..||..:|:   .:|....|   ::||...|   |.:|   ..:...| .:..:.|...:|...
Human    97 PDNLSQTSLIHLSSYVMNAEG---DEPSSKRRKHQGVIKRNWEYICSHD-KEKTKILGDKNVDPK 157

  Fly   302 CSAPVEGDDIRLLQWNILSQTLGQHNDGFVR-CPEEALTWEHRKYLIVQEILQNQPDVICLQEV- 364
            |.......|..::.:|||||.|.:.|....| |....|.|..|...|::||.....||:||||| 
Human   158 CEDSENKFDFSVMSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIKHFDADVLCLQEVQ 222

  Fly   365 -DHF-KFLQTVLGSQNYAGIFFPKPDSPCLY-IEQNNGPDGCAIFYKRDKLQLQGYDTRILEVWR 426
             ||: ..::..|.|..|          .|.| :.....||||||.:|..|..|...:.  :|.:|
Human   223 EDHYGAEIRPSLESLGY----------HCEYKMRTGRKPDGCAICFKHSKFSLLSVNP--VEFFR 275

  Fly   427 -----VQSNQVAIAARLRMR---SSGREFCVATTHL--KARHGAL----LAKLRNEQGRDLIRFV 477
                 :..:.|.:...|:.:   ::....|||.|||  ..|.|.:    ||.|..|    :....
Human   276 PDISLLDRDNVGLVLLLQPKIPYAACPAICVANTHLLYNPRRGDIKLTQLAMLLAE----ISSVA 336

  Fly   478 KQFAGD-TPLLLCGDFNAEPVEPIYATI----LGCDLLRLGSAYADVKLDREE------ILHPNA 531
            .|..|. .|:::|||||:.|..|:|:.|    |..:.|.:|......:..|.:      |..||.
Human   337 HQKDGSFCPIVMCGDFNSVPGSPLYSFIKEGKLNYEGLPIGKVSGQEQSSRGQRILSIPIWPPNL 401

  Fly   532 DVG-------EFVAKSMKREPPYTTWKIRE----------------------------------E 555
            .:.       :.|.|..|.:...|..::::                                  |
Human   402 GISQNCVYEVQQVPKVEKTDSDLTQTQLKQTEVLVTAEKLSSNLQHHFSLSSVYSHYFPDTGIPE 466

  Fly   556 GEECH-----TIDYVFYTPDR----------------LKIKNCLDFPAGEQIGK-NRTPSFQYPS 598
            ...||     |:||:||:.::                ||:...|.....:.:.. |..|:....|
Human   467 VTTCHSRSAITVDYIFYSAEKEDVAGHPGAEVALVGGLKLLARLSLLTEQDLWTVNGLPNENNSS 531

  Fly   599 DHFSLVCDFEL 609
            ||..|:..|.|
Human   532 DHLPLLAKFRL 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cuNP_001097746.1 EEP 312..609 CDD:382041 95/389 (24%)
ANGEL2NP_653168.2 EEP 169..542 CDD:321002 95/388 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.