DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cu and NGL1

DIOPT Version :9

Sequence 1:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_014600.1 Gene:NGL1 / 854115 SGDID:S000005402 Length:363 Species:Saccharomyces cerevisiae


Alignment Length:357 Identity:78/357 - (21%)
Similarity:141/357 - (39%) Gaps:81/357 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 LLQWNILSQTLGQHNDGFVRCPEEALTWEHRKYLIVQEILQN-QPDVICLQEV---DHFKFLQTV 373
            ||.:|:||.:. .....:....|....|.:|..|:.:|:|.. :.|::||||:   |:..:....
Yeast    29 LLTYNMLSPSY-MWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTARDYEDYWHDS 92

  Fly   374 LG-SQNYAGIFFPKPDSPCLYIEQNNGPDGCAIFY---KRDKLQLQG-YDTRILEVWRVQ----- 428
            :| ..||...|..| ..|..:.:.....||.:|||   |.|.:...| |..::|.|:..:     
Yeast    93 IGVDVNYGSKFISK-TPPKYWKKPVKDMDGVSIFYNLAKFDFISSSGIYLNQLLNVFNQRELKYL 156

  Fly   429 --------------------------SNQVAIAARLRMRSSGREFCVATTHLKARHGALLAKLRN 467
                                      .|||.:...||.:.:|..|.|..|||..::..:......
Yeast   157 YNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLRHKETGTIFVVLNTHLYWKYDEVKLTQCM 221

  Fly   468 EQGRDLIRFVKQ-FAGD------TPLLLCGDFNAEPVEPIYATILGCDLLRLGSAYADVKLDREE 525
            ...|:|.:.:|| ..||      ..:|..||.|:.. :.:....|...::    ::.|:.|    
Yeast   222 IIMRELSKIIKQLLPGDVKGQERVKILFTGDLNSTR-DSLVVNFLQGQIV----SHGDLNL---- 277

  Fly   526 ILHPNADVGEFVAKSMKREPP-----YTTWKIREEGEECHTIDYVFYTPDRLKIKNCL------- 578
             ::|   :..::.:.:..:.|     :|.:..:.:|    ..|||:|......:...|       
Yeast   278 -INP---MRPYLDRCVYDDIPKDYFVHTCYSGKLKG----IFDYVWYHDSDFLLTKILTGNEVSD 334

  Fly   579 DFPAGEQIGKNRTPSFQYPSDHFSLVCDFELL 610
            :..|..|:|   .|:..:||||..|:.:|::|
Yeast   335 ELLASNQLG---LPNENHPSDHIPLLTEFKIL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cuNP_001097746.1 EEP 312..609 CDD:382041 77/354 (22%)
NGL1NP_014600.1 CCR4 1..363 CDD:227564 77/355 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.