DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cu and ZNF503

DIOPT Version :9

Sequence 1:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_116161.2 Gene:ZNF503 / 84858 HGNCID:23589 Length:646 Species:Homo sapiens


Alignment Length:65 Identity:19/65 - (29%)
Similarity:27/65 - (41%) Gaps:17/65 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   568 TPDRLKIKNCLDFPAGEQIGKNRTPSFQYPSDHFSLVCDFELLPPTENGKESGSGSGSDGENETE 632
            :|..|..:.|      .|||| ..||   ||...|.|.       :..|...|:|.|:.|:.:|:
Human   111 SPLALLAQTC------SQIGK-PDPS---PSSKLSSVA-------SNGGGAGGAGGGAAGDKDTK 158

  Fly   633  632
            Human   159  158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cuNP_001097746.1 EEP 312..609 CDD:382041 13/40 (33%)
ZNF503NP_116161.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..332 16/49 (33%)
nlz1 355..415 CDD:289188
C2H2 Zn finger 516..542 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8132
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.