powered by:
Protein Alignment cu and ZNF503
DIOPT Version :9
Sequence 1: | NP_001097746.1 |
Gene: | cu / 41339 |
FlyBaseID: | FBgn0261808 |
Length: | 642 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_116161.2 |
Gene: | ZNF503 / 84858 |
HGNCID: | 23589 |
Length: | 646 |
Species: | Homo sapiens |
Alignment Length: | 65 |
Identity: | 19/65 - (29%) |
Similarity: | 27/65 - (41%) |
Gaps: | 17/65 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 568 TPDRLKIKNCLDFPAGEQIGKNRTPSFQYPSDHFSLVCDFELLPPTENGKESGSGSGSDGENETE 632
:|..|..:.| .|||| ..|| ||...|.|. :..|...|:|.|:.|:.:|:
Human 111 SPLALLAQTC------SQIGK-PDPS---PSSKLSSVA-------SNGGGAGGAGGGAAGDKDTK 158
Fly 633 632
Human 159 158
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S8132 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.