DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cu and AT1G31530

DIOPT Version :9

Sequence 1:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_174438.1 Gene:AT1G31530 / 840043 AraportID:AT1G31530 Length:283 Species:Arabidopsis thaliana


Alignment Length:310 Identity:77/310 - (24%)
Similarity:127/310 - (40%) Gaps:75/310 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 PEEALTWEHRKYLIVQEILQNQPDVICLQEVDHF-KFLQTVLGSQNYAGIFFPKPDSPCLYIEQN 397
            |.|::.||.|...|:..|...:.|.|||||||.: .|....:.:|.|:||       |   ||..
plant    11 PPESILWEKRSKAILDNIKNFEADFICLQEVDEYHSFFDRNMEAQGYSGI-------P---IENK 65

  Fly   398 NGPDGCAIFYK--------RDKLQLQGY---------------DTRILEVWRVQSNQVAIAARLR 439
            .|.: ||||:|        ....::|||               .:...:|...:...|.:.|...
plant    66 EGYE-CAIFFKPKFAEFITYQTTRIQGYTKYENLCVAPSSSTVSSESSDVVNAEELSVVMVAFKI 129

  Fly   440 MRSSGREFCVATTHLKARHGALLAKLRNEQGRDLI-------RFVKQFAGDTP-LLLCGDFNAEP 496
            ::.......:|::|||:........|:..|.:.|:       ..:......:| ::|.||||::|
plant   130 LKPFNHVVIIASSHLKSGKPDRWDDLKLAQVKTLMTELASFKEIISALTNCSPSVILAGDFNSKP 194

  Fly   497 VEPIYATILGCDLLRLGSAYADVKLDREEILHPNADVGEFVAKSMKREPPYTTWKIREEGEECHT 561
            ....|        :...:..:|:.|         ..|.||.    |.||.:|. .:....|   |
plant   195 YVHKY--------INSDNIPSDIDL---------RSVYEFT----KGEPRFTN-NVPGFAE---T 234

  Fly   562 IDYVFYTPDRL--KIKNCLDFPAGEQIGKNRTPSFQYPSDHFSLVCDFEL 609
            :||:|||...:  .:| .||.|  :::  :..|:..:||||..:..:||:
plant   235 LDYMFYTHSEIISPVK-LLDSP--DEV--DFLPNEIHPSDHLPIGVEFEI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cuNP_001097746.1 EEP 312..609 CDD:382041 76/308 (25%)
AT1G31530NP_174438.1 EEP 7..279 CDD:294334 76/308 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105986
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.