DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cu and AT1G31500

DIOPT Version :9

Sequence 1:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_001323328.1 Gene:AT1G31500 / 840040 AraportID:AT1G31500 Length:422 Species:Arabidopsis thaliana


Alignment Length:451 Identity:117/451 - (25%)
Similarity:184/451 - (40%) Gaps:130/451 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LVLPSG----------LST-PALLQHVQQLRGGGIEQPSLLTRG-----FLKPLLADEDVADGLR 291
            |:|||.          :|| ||:...|::..  .:|...:.:|.     |..||...:.|| ...
plant    15 LLLPSSRVCRKVISRRMSTNPAIEPKVRKFE--SVEGVDIGSRNKSDGFFAIPLYLSKLVA-LYN 76

  Fly   292 CLKLNSVSRVCSA----PVEGDDIRLLQWNILSQ-----TLGQHNDGFVRCPEEALTWEHRKYLI 347
            |:   |:||:.::    ...|...||:.:|||:|     .|..|:      |...|.|:.|.:.|
plant    77 CI---SLSRIGTSNENFVFSGIRFRLVSYNILAQVYVKSALLPHS------PPACLKWKARSHAI 132

  Fly   348 VQEILQNQPDVICLQEVDHF-KFLQTVLGSQNYAGIFFPKPDSPCLYIEQNNGP---DGCAIFYK 408
            :..:...|.|..||||||.: .|.:..:.|..|:||:.           |..|.   ||||||||
plant   133 LSVLKNLQADFFCLQEVDEYDSFYRNNMDSLGYSGIYI-----------QRTGQRKRDGCAIFYK 186

  Fly   409 RDKLQL-------------------------------QGYDTRILE------VWRVQSNQVAIAA 436
            ....:|                               :|.|:|...      :.|::.:.|.|.|
plant   187 PSCAELVTKERIEYNDLVDSIKADSVSCSEQKIETSNEGKDSRKDSRDLNDPLVRLKRDCVGIMA 251

  Fly   437 RLRMRSSGREF-CVATTHLKARHGALLAKLRNEQGRDLIRFVKQF---AGD----TP-LLLCGDF 492
            ..|:....:.. .||.|||  .....||.::..|.:.|:..:.||   ..|    || |||.|||
plant   252 AFRINKPFQHIVIVANTHL--YWDPELADVKLAQAKYLLSRLAQFKTLISDEFECTPSLLLAGDF 314

  Fly   493 NAEPVEPIYATILGCDLLRLGSAYADVKLDREEILHPNADVGEFVAKSMKREPPYTTWKIREEGE 557
            |:.|.:.:|:.::.      |:|.....::.||...|.:.|.|..    :.||.:|         
plant   315 NSIPGDMVYSYLVS------GNAKPTETIEEEEAPVPLSSVYEVT----RGEPKFT--------- 360

  Fly   558 EC-----HTIDYVFYTP-DRLKIKNCLDFP---AGEQIGKNRTPSFQYPSDHFSLVCDFEL 609
            .|     :|:||:|.:| |.:|..:.|..|   :.:.:|  ..|:..:||||..:..:||:
plant   361 NCTPGFTNTLDYIFISPSDFIKPVSILQLPEPDSPDVVG--FLPNHHHPSDHLPIGAEFEI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cuNP_001097746.1 EEP 312..609 CDD:382041 95/360 (26%)
AT1G31500NP_001323328.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.