DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cu and LRRC27

DIOPT Version :10

Sequence 1:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_085129.1 Gene:LRRC27 / 80313 HGNCID:29346 Length:530 Species:Homo sapiens


Alignment Length:221 Identity:46/221 - (20%)
Similarity:71/221 - (32%) Gaps:77/221 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RQPALGKAMPVTALLL-NLESNPL----DYSRNDIGAELLEDDD--------------KPPQLFS 61
            |.|...:|.||..:.| :|.|..|    |::.|. ||...:|.:              :.|.|..
Human   179 RNPTSQEAPPVREMTLRDLPSPGLELSGDHASNQ-GAVNAQDPEGAVMKEKASFLPPVEKPDLSE 242

  Fly    62 VTDEPPS----PNEEDYK---------------------------PPNHHEDDGKLAGERHREIP 95
            :.....|    |:||:.:                           |||.     |.|....:|:|
Human   243 LRKSADSSENWPSEEEIRRFWKLRQEIVEHVKADVLGDQLLTRELPPNL-----KAALNIEKELP 302

  Fly    96 CSNCLKTAPGHLIDRQSAINEMCQRLCGPECRRPQGLTLDGVRQDFLRQYEIAEAVAKTSAMTST 160
                   .|.|:..|::|    ..|...|:...|..:.:...|.:..|...:.|...|.:.|...
Human   303 -------KPRHVFRRKTA----SSRSILPDLLSPYQMAIRAKRLEESRAAALRELQEKQALMEQQ 356

  Fly   161 VQMK----------QRLAARKLEFEK 176
            .:.|          ||:..||.|..|
Human   357 RREKRALQEWRERAQRMRKRKEELSK 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cuNP_001097746.1 EEP 312..609 CDD:469791
LRRC27NP_085129.1 LRR 1 46..67
LRR <49..>155 CDD:443914
leucine-rich repeat 49..68 CDD:275378
LRR 2 68..89
leucine-rich repeat 69..92 CDD:275378
LRR 3 92..113
leucine-rich repeat 93..115 CDD:275378
LRR 4 115..136
leucine-rich repeat 116..138 CDD:275378
LRR 5 138..159
leucine-rich repeat 139..150 CDD:275378
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..215 12/36 (33%)
PTZ00121 <225..496 CDD:173412 32/174 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..432
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.