DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cu and Angel1

DIOPT Version :9

Sequence 1:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster
Sequence 2:XP_011242471.1 Gene:Angel1 / 68737 MGIID:1915987 Length:690 Species:Mus musculus


Alignment Length:459 Identity:101/459 - (22%)
Similarity:150/459 - (32%) Gaps:194/459 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 LLQWNILSQTL-GQHNDGFVRCPEEALTWEHRKYLIVQEILQNQPDVICLQEV--DHF-KFLQTV 373
            |:.:|||:|.| .|.::.::.|..:.|.|.:|...::||.....||::|||||  ||: :.|:..
Mouse   267 LMSYNILAQDLMQQSSELYLHCHPDILNWNYRFANLMQEFQHWDPDILCLQEVQEDHYWEQLEPS 331

  Fly   374 LGSQNYAGIFFPKPDSPCLYIEQNNG--PDGCAIFYK---------------RDKLQLQGYDTRI 421
            |....:.          |.| ::..|  .||||:.||               |..|:|...|...
Mouse   332 LRMMGFT----------CFY-KRRTGCKTDGCAVCYKPTRFRLLCASPVEYFRPGLELLNRDNVG 385

  Fly   422 LEVWRVQS------NQVAIAARLRMRSSGREFCVATTHL----------KARHGALLAKLRNEQG 470
            | |..:|.      .||::|          ..|||.||:          .|:...|||::     
Mouse   386 L-VLLLQPLVPEGLGQVSVA----------PLCVANTHVLYNPRRGDVKLAQMAILLAEV----- 434

  Fly   471 RDLIRFVKQFAGDTPLLLCGDFNAEPVEPIYATI------------------------------- 504
             |.:..:.. ....|::||||.|:.|..|:|..|                               
Mouse   435 -DKVARLSD-GSHCPIILCGDLNSVPDSPLYNFIRDGELQYNGMPAWKVSGQEDFSHQLYQRKLQ 497

  Fly   505 -------LG-------------------------------CDL-------LRLGSAYADVKLDR- 523
                   ||                               |||       |.|.....|.|.|| 
Mouse   498 APLWPSSLGITDCCQYVTSCHPKRSERLKYGRDFLLRFRFCDLACQRPVGLVLMEGVTDTKPDRP 562

  Fly   524 ---------EEI-----------------LHPNADVGEFVAKSMKREPPYTTWKIREEGEECHTI 562
                     |||                 ||..:....|:.:  ...|..||..:...    .|:
Mouse   563 AGWAECIFEEEISELEPVFPRTIGTIQHCLHLTSVYTHFLPQ--HGCPEVTTMPLGLG----MTV 621

  Fly   563 DYVFYTPDRLKIKNCLDFP---------------AGEQI--GKNRTPSFQYPSDHFSLVCDF--E 608
            ||:|::.:..:.:|..|..               ..|:|  ..|..|:..|.|||..|:..|  |
Mouse   622 DYIFFSAESCENENRTDHRLDRDGTLKLLGRLSLLSEEILWAANGLPNPFYSSDHLCLLASFGME 686

  Fly   609 LLPP 612
            :..|
Mouse   687 VTAP 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cuNP_001097746.1 EEP 312..609 CDD:382041 99/454 (22%)
Angel1XP_011242471.1 EEP 268..683 CDD:382041 97/449 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.