DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cu and cnot6b

DIOPT Version :9

Sequence 1:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_001103498.1 Gene:cnot6b / 560386 ZFINID:ZDB-GENE-071004-97 Length:558 Species:Danio rerio


Alignment Length:351 Identity:93/351 - (26%)
Similarity:131/351 - (37%) Gaps:87/351 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 CPEEALTWEHRKYLIVQEILQNQPDVICLQEVD---HFKFLQTVLGSQNYAGIFFPKPDSPCLYI 394
            ||..||.|.:||..|:||||....|:|.||||:   :|.|....|..|.|.|.|.||..:..:..
Zfish   210 CPSWALNWSYRKKSIMQEILNCNADIISLQEVETEQYFDFFLLELSKQGYDGFFSPKSRARTMSE 274

  Fly   395 EQNNGPDGCAIFYKRDKLQLQGYDTRILEVWRVQSNQVAIAARLRMRSSGREFCVATTHLKARHG 459
            ......||||||||.:|.       .:::...|:.||:|:|     .|.|.|..:.....|...|
Zfish   275 SDRKHVDGCAIFYKTEKF-------NVVQKHTVEFNQLAMA-----NSEGSEAMLNRVMTKDNIG 327

  Fly   460 -ALLAKLRNE-----QGRDLIRFVKQF-------------------------------------- 480
             |:|.:|:.|     .|:.:....||.                                      
Zfish   328 VAVLLELKKELIEVSSGKSIHPMEKQLLLVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASR 392

  Fly   481 -------AGDT---PLLLCGDFNAEPVEPI--YATILGCDL-------LRLGSAYADVKLDREEI 526
                   :|:|   ||:||.|.|:.|...:  |.:..|.|.       ||...:..:...:.:..
Zfish   393 SLKHSSVSGETSSIPLVLCADLNSLPDSGVVEYLSTGGVDCTHKDFKELRYSDSLTNFNCNGKNS 457

  Fly   527 LHPNADVGEFVAKSMKRE--PPYTTWKIREEGEECHTIDYVFYTPDRLKIKNCLDFPAGEQIGKN 589
            .........|..||....  .|||.:.....|    .|||:||:..:|.:...|.......:.:|
Zfish   458 TSNGRITHAFKLKSAYENGLMPYTNYTFDFRG----VIDYIFYSRPQLNVLGVLGPLDTNWLLEN 518

  Fly   590 R---TPSFQYPSDHFSLVCDFELLPP 612
            .   .|....|||||||....||:.|
Zfish   519 NISGCPHPLIPSDHFSLFAQLELVLP 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cuNP_001097746.1 EEP 312..609 CDD:382041 90/346 (26%)
cnot6bNP_001103498.1 LRR_8 51..109 CDD:290566
LRR_4 51..91 CDD:289563
leucine-rich repeat 53..75 CDD:275380
LRR_4 75..113 CDD:289563
leucine-rich repeat 76..98 CDD:275380
leucine-rich repeat 99..121 CDD:275380
Deadenylase_CCR4a 191..541 CDD:197340 90/346 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.