DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cu and Lrrc27

DIOPT Version :9

Sequence 1:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_001137228.1 Gene:Lrrc27 / 499281 RGDID:1559981 Length:513 Species:Rattus norvegicus


Alignment Length:451 Identity:87/451 - (19%)
Similarity:140/451 - (31%) Gaps:155/451 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 INLGQSSTVAATGMGEFEFEPPRDLLLY--LVRMGSFNSAPKINNVDSQDDGLV-LPSGLSTPAL 254
            :.|||.:|:.|..:.....|.|..|::.  ||.:.:|.....:.|....|:.|. :|:..|...|
  Rat   132 VELGQVTTLTALNLRHCPLEFPPYLIVQKGLVSILTFLRICSVENAFPGDESLPGVPTAKSDLLL 196

  Fly   255 -LQHVQQLRGGG---IEQPSLLTR---GFLKPLLADEDVADGLRCLKLNSVSRVCSAPVEGDDIR 312
             |.|.......|   ::|.:.:.:   .|..|:    |..|.....|.:|.|.:..:.   ::||
  Rat   197 PLPHKDLSSENGLNVLDQEAAVVKEKGDFFPPM----DRLDLSELRKSSSSSEIWPSK---EEIR 254

  Fly   313 LLQWNILSQTLGQHNDGFVRCPEEALTWEHRKYLIVQEILQNQPDVICLQEVDHFKFLQTVL--- 374
            ..                         |:.|     |||::|:.     .||...|.|...|   
  Rat   255 RF-------------------------WKLR-----QEIVENEQ-----VEVQENKLLAVELPPN 284

  Fly   375 ---------------------GSQNYAGIFFPKPDSPCLY---IEQNNGPDGCAIFY-----KRD 410
                                 .|.::.||.   |:....|   :......|...:.:     |..
  Rat   285 LKAAINAKERKCRKPWPTLRKRSTSFRGIL---PNLSSTYQNTVHTKRMDDTHKMAFQELQEKER 346

  Fly   411 KLQLQGYDTRILEVWRVQSNQVAIAARLRMRSSGREFCVATTHLKARHGALLAKLRNEQGRDLIR 475
            .|:.|..|.|.|:.||.|:.      .:|.|   |||    :..:..|       ||.....:  
  Rat   347 MLEQQRRDKRALQDWREQTQ------LMRHR---REF----SKFQPLH-------RNTMASKI-- 389

  Fly   476 FVKQFAGDTPLLLCGDFNAEPVEPIYATILGCDLLRLGSAYADVKLDREEILHPNADVG------ 534
               .||.|..     |:...|..|                :..||..||.|.....::.      
  Rat   390 ---PFATDLT-----DYEKMPASP----------------FGKVKPRREGIAQKRIEISTSPLAE 430

  Fly   535 ----------EFVAKSMKREPPYTTWKIREEGEECHTIDYVFYTPDRLKIKNCLD----FP 581
                      :..|:|.....|  |..|:...::..|...:.....|||::..|:    ||
  Rat   431 LEDKIRRHTQQIRARSFLGTNP--TQDIKTANQDLETTKKLQEELRRLKLEMTLNKDHSFP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cuNP_001097746.1 EEP 312..609 CDD:382041 58/322 (18%)
Lrrc27NP_001137228.1 PLN00113 30..>173 CDD:215061 11/40 (28%)
leucine-rich repeat 50..69 CDD:275378
LRR_8 68..127 CDD:404697
leucine-rich repeat 70..93 CDD:275378
leucine-rich repeat 94..116 CDD:275378
leucine-rich repeat 117..139 CDD:275378 3/6 (50%)
leucine-rich repeat 140..151 CDD:275378 1/10 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.