DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cu and twin

DIOPT Version :10

Sequence 1:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster


Alignment Length:350 Identity:88/350 - (25%)
Similarity:140/350 - (40%) Gaps:81/350 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 CPEEALTWEHRKYLIVQEILQNQPDVICLQEVD---HFKFLQTVLGSQNYAGIFFPKPDSPCLYI 394
            ||..||.||:||..|:.||.....|:|.|||::   .:.|....|.:..|.|||.||..:..:..
  Fly   228 CPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSE 292

  Fly   395 EQNNGPDGCAIFYKRDKLQL----------------QGYDTRILEVWRVQSNQVAIAARLRMRSS 443
            .:....||||||::..|..|                :|.|..:..|  :..:.:.:||.|:::.:
  Fly   293 LERKYVDGCAIFFRASKFTLIKESLIEFNQLAMANAEGSDNMLNRV--MPKDNIGLAALLKVKEN 355

  Fly   444 GRE-------------FCVATTH-------LKARHGALLAK----LRNEQGRDLIRFVKQFAGDT 484
            ..|             .|.|..|       :|.....:|:.    :.:|.........|..:...
  Fly   356 AWEPMSEVTQISQPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAV 420

  Fly   485 PLLLCGDFNAEPVEPIYATILGCDLLRLGSAYADVKLDREEILHPNA-------DVGEF-----V 537
            .||||||||:.|...:      .:.|..|....| .||.:::.:.:.       |..||     :
  Fly   421 QLLLCGDFNSLPDSGV------VEFLGKGRVSMD-HLDFKDMGYKSCLQRLLSNDTNEFTHSFKL 478

  Fly   538 AKSMKRE-PPYTTWKIREEGEECHTIDYVFYTPDRLKIKNCLDFPAGEQIGKNRT---PSFQYPS 598
            |.:...: .|:|.:....:|    .|||:|||...:.....|...:.:.:.:|:.   |....||
  Fly   479 ASAYNEDIMPHTNYTFDFKG----IIDYIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPS 539

  Fly   599 DHFSLVCDFELL-------PPTENG 616
            |||.|:.:.||:       ||  ||
  Fly   540 DHFPLLVELELMHTASQQAPP--NG 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cuNP_001097746.1 EEP 312..609 CDD:469791 82/334 (25%)
twinNP_732964.1 LRR <52..>155 CDD:443914
leucine-rich repeat 76..98 CDD:275378
leucine-rich repeat 99..121 CDD:275378
leucine-rich repeat 122..144 CDD:275378
leucine-rich repeat 145..156 CDD:275378
Deadenylase_CCR4 209..550 CDD:197331 82/334 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.