DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cu and Cnot6

DIOPT Version :9

Sequence 1:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_001380807.1 Gene:Cnot6 / 287249 RGDID:1310783 Length:557 Species:Rattus norvegicus


Alignment Length:338 Identity:91/338 - (26%)
Similarity:135/338 - (39%) Gaps:62/338 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 CPEEALTWEHRKYLIVQEILQNQPDVICLQEVD---HFKFLQTVLGSQNYAGIFFPKPDSPCLYI 394
            ||..||.|::||..|:||||....|:|.||||:   ::.|....|..:.|.|.|.||..:..:..
  Rat   210 CPSWALNWDYRKKAIIQEILSCNADIISLQEVETEQYYSFFLVELKERGYNGFFSPKSRARTMSE 274

  Fly   395 EQNNGPDGCAIFYKRDKLQL----------------QGYDTRILEVWRVQSNQVAIAARLRMR-- 441
            ::....||||||:|.:|..|                :|.:..:..|....:..||:...||..  
  Rat   275 QERKHVDGCAIFFKTEKFTLVQKHTVEFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKELI 339

  Fly   442 --SSGRE--------FCVATTHLK----------ARHGALLAKLRN---EQGRDLIRFVKQFAGD 483
              |||:.        ..||..|:.          .:....|::::|   :..|.|...|....|.
  Rat   340 EMSSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRSLKSSVLGECGT 404

  Fly   484 TPLLLCGDFNAEPVEPI--YATILGCDL-------LRLGSAYADVKLDREEILHPNADVGEFVAK 539
            .||:||.|.|:.|...:  |.:..|.:.       ||...:..:...:.:..:........|..|
  Rat   405 IPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCNGKNGMTNGRITHGFKLK 469

  Fly   540 SMKRE--PPYTTWKIREEGEECHTIDYVFYTPDRLK---IKNCLDFPAGEQIGKNRTPSFQYPSD 599
            |....  .|||.:....:|    .|||:||:..:|.   |...||.....:...:..|....|||
  Rat   470 SAYENGLMPYTNYTFDFKG----IIDYIFYSKPQLNTLAILGPLDHHWLVENNISGCPHPLIPSD 530

  Fly   600 HFSLVCDFELLPP 612
            ||||....|||.|
  Rat   531 HFSLFAQLELLLP 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cuNP_001097746.1 EEP 312..609 CDD:382041 87/333 (26%)
Cnot6NP_001380807.1 LRR <52..>159 CDD:227223
LRR 1 52..73
leucine-rich repeat 53..75 CDD:275378
LRR 2 75..96
leucine-rich repeat 76..98 CDD:275378
LRR 3 98..120
leucine-rich repeat 99..121 CDD:275378
LRR 4 121..143
leucine-rich repeat 122..133 CDD:275378
Nuclease domain. /evidence=ECO:0000250 153..557 91/338 (27%)
Deadenylase_CCR4a 191..540 CDD:197340 87/333 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.