DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cu and angel2

DIOPT Version :9

Sequence 1:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster
Sequence 2:XP_002934749.2 Gene:angel2 / 100379750 XenbaseID:XB-GENE-985562 Length:526 Species:Xenopus tropicalis


Alignment Length:408 Identity:100/408 - (24%)
Similarity:159/408 - (38%) Gaps:114/408 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 KLNSVSRVCSAPVEGDDIRLLQWNILSQTLGQHNDG-FVRCPEEALTWEHRKYLIVQEILQNQPD 357
            :|:..:||.....|..|..:|.:|||||.|.:.|.. :..|....|.|.:|...|::|::....|
 Frog   139 ELSKWNRVFGRDPEYFDFTVLSYNILSQDLLEDNSHLYDHCRRPLLFWSYRLPNILKELVDLNAD 203

  Fly   358 VICLQEV--DHFKF-LQTVLGSQNYAGIFFPKPDSPCLY-IEQNNGPDGCAIFYKRDKLQLQGYD 418
            ::|||||  ||:.. ::..|.|..|          .|.| ....:.||||||.:|.:|..|  ..
 Frog   204 ILCLQEVQEDHYTTQIKPSLESLGY----------HCEYKTRTGSKPDGCAICFKANKFSL--VS 256

  Fly   419 TRILEVWR-----VQSNQVAIAARLRMRSS--GREFCVATTHL--KARHG--------ALLAKLR 466
            ...:|.:|     :..:.:.:...||.:|.  ....|||.|||  ..|.|        .|||::.
 Frog   257 VTPVEYYRPNISLLDRDNIGLVLLLRPKSQRVAPVICVANTHLLYNPRRGDIKLAQLAILLAEIT 321

  Fly   467 NEQGRDLIRFVKQFAGDTPLLLCGDFNAEPVEPIYATI----LGCDLLRLGSAYADVKLDR-EEI 526
            :      :.|..: .|..|::||||||:.|..|:::.|    |..:.|.:|......:..| ::|
 Frog   322 S------VAFTGE-KGFCPIVLCGDFNSVPGSPLHSFIREGRLNYEGLSIGKVSGQEQYPRGQKI 379

  Fly   527 LH----PNADVGEFVAKSMKREPPYTTWKIRE--------------------------------- 554
            |.    |.: :|  ::::...||....|...|                                 
 Frog   380 LSIPIWPKS-LG--ISQNCVYEPMENAWNAAEMVDKESVGNSARNRQVEPSLSHHFSLSSVYTHF 441

  Fly   555 -------EGEECH-----TIDYVFY---------------TPDRLKIKNCLDFPAGEQI-GKNRT 591
                   |...||     |:||:||               :.:.|::...|.....:.: ..|..
 Frog   442 FPGSGIPEITTCHSRCALTVDYIFYSAAANDLFAQLGTNSSQNGLQLLGRLSLLTEQDLWSVNGL 506

  Fly   592 PSFQYPSDHFSLVCDFEL 609
            |:....|||.||:..|.|
 Frog   507 PNETNSSDHLSLLAKFRL 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cuNP_001097746.1 EEP 312..609 CDD:382041 94/388 (24%)
angel2XP_002934749.2 PLN03144 <148..523 CDD:178689 95/396 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.