DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35A1 and AT5G03490

DIOPT Version :9

Sequence 1:NP_524314.2 Gene:Ugt35A1 / 41334 FlyBaseID:FBgn0026315 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_195969.1 Gene:AT5G03490 / 831823 AraportID:AT5G03490 Length:465 Species:Arabidopsis thaliana


Alignment Length:496 Identity:103/496 - (20%)
Similarity:164/496 - (33%) Gaps:140/496 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LAVFPFPGRSQYIFAEQFMKELAHRGHNVTVINTFGSDKNEPNFRVIGAKKIHEIMAAFGNADYT 99
            :.|||||.:...:.......:|..||.||:||.|.|:                            
plant    20 IVVFPFPAQGHLLPLLDLTHQLCLRGFNVSVIVTPGN---------------------------- 56

  Fly   100 QTASQWQMLTMTTQFLNLLTTSILDDA--------------AVKDLLNSGEKFDLVIMEAVQ--T 148
                    ||..:..|:...:|:....              .|||:.|||   :|.||.:::  .
plant    57 --------LTYLSPLLSAHPSSVTSVVFPFPPHPSLSPGVENVKDVGNSG---NLPIMASLRQLR 110

  Fly   149 EALFGLIQ------------------HFGAETIGIS-------SYGTDTHIDELMGNISPL-SYN 187
            |.:....|                  |.....|||.       |:...:.:.....||..: |.:
plant   111 EPIINWFQSHPNPPIALISDFFLGWTHDLCNQIGIPRFAFFSISFFLVSVLQFCFENIDLIKSTD 175

  Fly   188 PLLLSSRTEQMDFKDRVMNVFEASVMWLHKRIVHLPSQRDLYAKYFPTARKSLDEVLD-SFALML 251
            |:.|........||:.                 ||||   :..:...|....|:.:.| |..|:.
plant   176 PIHLLDLPRAPIFKEE-----------------HLPS---IVRRSLQTPSPDLESIKDFSMNLLS 220

  Fly   252 LGQHFS----------------LSYPRPY-LPNMIEVGGLHLQQKRKVQPLAKELSEFVEQSEKG 299
            .|..|:                :.:.|.| :..:..:|.........|.|   .|..:::.|..|
plant   221 YGSVFNSSEILEDDYLQYVKQRMGHDRVYVIGPLCSIGSGLKSNSGSVDP---SLLSWLDGSPNG 282

  Fly   300 -VIYFSMGSNIKSKDLPPSTRKMLMQTFASVPQRVLWKFEDDQLPEKPDN------VFISKWFPQ 357
             |:|...||   .|.|.......|.........|.:|..:.|.:|:..::      :.:..|..|
plant   283 SVLYVCFGS---QKALTKDQCDALALGLEKSMTRFVWVVKKDPIPDGFEDRVSGRGLVVRGWVSQ 344

  Fly   358 PDILAHPNVKLFITHGGLLSTIESIYFGKPILGLPIFYDQHLNVQRAKQVGYGLSADIWSVNAT- 421
            ..:|.|..|..|::|.|..|.:|.|..|..|||.|:..||.:|. |......|::..:.....| 
plant   345 LAVLRHVAVGGFLSHCGWNSVLEGITSGAVILGWPMEADQFVNA-RLLVEHLGVAVRVCEGGETV 408

  Fly   422 ----ELTPLIQELLSNPSYAAAAQTKSKLFRDQKETALERA 458
                ||..:|.|.:.......||:.:.  .|.:.|.|:..|
plant   409 PDSDELGRVIAETMGEGGREVAARAEE--IRRKTEAAVTEA 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35A1NP_524314.2 egt 19..474 CDD:223071 103/496 (21%)
UDPGT 55..526 CDD:278624 98/476 (21%)
AT5G03490NP_195969.1 Glycosyltransferase_GTB_type 19..460 CDD:299143 103/496 (21%)
YjiC 19..447 CDD:224732 102/494 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.