DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35A1 and UGT71B5

DIOPT Version :9

Sequence 1:NP_524314.2 Gene:Ugt35A1 / 41334 FlyBaseID:FBgn0026315 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001328018.1 Gene:UGT71B5 / 827194 AraportID:AT4G15280 Length:510 Species:Arabidopsis thaliana


Alignment Length:227 Identity:55/227 - (24%)
Similarity:90/227 - (39%) Gaps:63/227 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 LPNMIEVGG-LHLQQKRKVQPLAKELSEFV-EQSEKGVIYFSMGSNIKSKDLPPSTRKMLMQTFA 327
            ||.:..||. |||:..........|:..:: ||..|.|::...||      |...|.:...:|..
plant   268 LPQVYPVGPVLHLENGNDDDEKQSEILRWLDEQPSKSVVFLCFGS------LGGFTEEQTRETAV 326

  Fly   328 SVP---QRVLWKFE-----------------DDQLPE-----KPDNVFISKWFPQPDILAHPNVK 367
            ::.   ||.||...                 ::.|||     ..|...:..|.||..:|..|.:.
plant   327 ALDRSGQRFLWCLRHASPNIKTDRPRDYTNLEEVLPEGFLERTLDRGKVIGWAPQVAVLEKPAIG 391

  Fly   368 LFITHGGLLSTIESIYFGKPILGLPIFYDQHLNV-QRAKQVGYGLSADIWSVNATELTPLIQELL 431
            .|:||.|..|.:||::||.|::..|::.:|.:|. :..:::|..:.              |::.|
plant   392 GFVTHCGWNSILESLWFGVPMVTWPLYAEQKVNAFEMVEELGLAVE--------------IRKYL 442

  Fly   432 SNPSYAAAAQTKSKLFRDQKETA----LERAI 459
                       |..||..:.||.    :||||
plant   443 -----------KGDLFAGEMETVTAEDIERAI 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35A1NP_524314.2 egt 19..474 CDD:223071 55/227 (24%)
UDPGT 55..526 CDD:278624 55/227 (24%)
UGT71B5NP_001328018.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.