DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35A1 and AT3G22250

DIOPT Version :9

Sequence 1:NP_524314.2 Gene:Ugt35A1 / 41334 FlyBaseID:FBgn0026315 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_188864.1 Gene:AT3G22250 / 821795 AraportID:AT3G22250 Length:461 Species:Arabidopsis thaliana


Alignment Length:173 Identity:42/173 - (24%)
Similarity:73/173 - (42%) Gaps:30/173 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 PNMIEVGGLHLQQKRKVQPLAKE---------LSEFVEQSEKGVIYFSMGSNIKSKDLPPSTRKM 321
            |.::.:|.||.|:......:.|.         |....||:...|||.|.||.:  ..:..|..:.
plant   242 PQILHLGPLHNQEATNNITITKTSFWEEDMSCLGWLQEQNPNSVIYISFGSWV--SPIGESNIQT 304

  Fly   322 LMQTFASVPQRVLWK----FEDDQLPEKPDNVFISK-------WFPQPDILAHPNVKLFITHGGL 375
            |.....:..:..||.    :::...|.....|.|:|       |.||.::|.:.:|..::||.|.
plant   305 LALALEASGRPFLWALNRVWQEGLPPGFVHRVTITKNQGRIVSWAPQLEVLRNDSVGCYVTHCGW 369

  Fly   376 LSTIESIYFGKPILGLPIFYDQHLNVQRAKQVGYGLSADIWSV 418
            .||:|::...:.:|..|:..||.:|   .|.:     .|:|.:
plant   370 NSTMEAVASSRRLLCYPVAGDQFVN---CKYI-----VDVWKI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35A1NP_524314.2 egt 19..474 CDD:223071 42/173 (24%)
UDPGT 55..526 CDD:278624 42/173 (24%)
AT3G22250NP_188864.1 PLN02562 1..461 CDD:215305 42/173 (24%)
YjiC 6..445 CDD:224732 42/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.