DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35A1 and AT2G29710

DIOPT Version :9

Sequence 1:NP_524314.2 Gene:Ugt35A1 / 41334 FlyBaseID:FBgn0026315 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_180532.1 Gene:AT2G29710 / 817521 AraportID:AT2G29710 Length:467 Species:Arabidopsis thaliana


Alignment Length:237 Identity:63/237 - (26%)
Similarity:92/237 - (38%) Gaps:55/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 LGQHFSLSYPRPYLPNMIEVGGLHLQQKRKVQPLAKELSEFVEQSEKGVIYFSMGSNIKSKDLPP 316
            ||:.   :||..|....|.....|....:.:....:.:.....|.|..|::...||       ..
plant   231 LGEE---NYPSVYAVGPIFNPKAHPHPDQDLACCDESMKWLDAQPEASVVFLCFGS-------MG 285

  Fly   317 STRKMLMQTFAS----VPQRVLWKF------EDDQLPEK-PDNV----FISKWFPQPDILAHPNV 366
            |.|..|::..|.    ...|.||..      .||.|||. .|.|    .|..|.||.:||||..|
plant   286 SLRGPLVKEIAHGLELCQYRFLWSLRTEEVTNDDLLPEGFMDRVSGRGMICGWSPQVEILAHKAV 350

  Fly   367 KLFITHGGLLSTIESIYFGKPILGLPIFYDQHLN----VQRAK-----QVGYGL-SADIWSVNAT 421
            ..|::|.|..|.:||::||.||:..|::.:|.||    |:..|     ::.|.: |.:|.|.|..
plant   351 GGFVSHCGWNSIVESLWFGVPIVTWPMYAEQQLNAFLMVKELKLAVELKLDYSVHSGEIVSANEI 415

  Fly   422 E--------------------LTPLIQELLSNPSYAAAAQTK 443
            |                    ::.:||....|...:.||..|
plant   416 ETAISCVMNKDNNVVRKRVMDISQMIQRATKNGGSSFAAIEK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35A1NP_524314.2 egt 19..474 CDD:223071 63/237 (27%)
UDPGT 55..526 CDD:278624 63/237 (27%)
AT2G29710NP_180532.1 PLN02207 1..467 CDD:177857 63/237 (27%)
YjiC 7..466 CDD:224732 63/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.