DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35A1 and AT2G23210

DIOPT Version :9

Sequence 1:NP_524314.2 Gene:Ugt35A1 / 41334 FlyBaseID:FBgn0026315 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001318272.1 Gene:AT2G23210 / 816853 AraportID:AT2G23210 Length:287 Species:Arabidopsis thaliana


Alignment Length:285 Identity:54/285 - (18%)
Similarity:92/285 - (32%) Gaps:121/285 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 HKRIVHLPSQRDL-----YAKYFPTARKSLDEVLDSFALMLLGQHFSL-----------SYPRPY 264
            |..:|.||.|..|     :||:.  ||.:|              ||:|           |...|:
plant    10 HVLMVALPFQGHLNPMLKFAKHL--ARTNL--------------HFTLATIESARDLLSSTDEPH 58

  Fly   265 LPNMIEV----GGLHLQQKRKVQPLAKELSEFVEQSEKGVIYFSMGSNIKSK-----------DL 314
              :::::    .||.....|..:||.:.|.:             :|:|..||           .:
plant    59 --SLVDLVFFSDGLPKDDPRDHEPLTESLRK-------------VGANNFSKIIEGKRFDCIISV 108

  Fly   315 PPSTRKMLMQTFASVPQRVLW------------------KFED----DQLPEKPDNVFISKWFPQ 357
            |.:.....:....::|..:||                  .|.|    :|..|.|...|:      
plant   109 PFTPWVPAVAAAHNIPCAILWIEACAGFSVYYRYYMKTNSFPDLEDPNQKVELPGLPFL------ 167

  Fly   358 PDILAHPNVKLFITHGGLLST---------------------------IESIYFGKPILGL-PIF 394
             ::...|.:.| .:||.:.:|                           |||::..|||:.: |:.
plant   168 -EVRDLPTLML-PSHGAIFNTLMAEFVECLKDVKWVLANSFYELESVIIESMFDLKPIIPIGPLV 230

  Fly   395 YDQHLNVQRAKQVGYGLSADIWSVN 419
            ....|.....|.:. |.|.|:|..:
plant   231 SPFLLGADEDKILD-GKSLDMWKAD 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35A1NP_524314.2 egt 19..474 CDD:223071 54/285 (19%)
UDPGT 55..526 CDD:278624 54/285 (19%)
AT2G23210NP_001318272.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.