DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35A1 and LOC571561

DIOPT Version :9

Sequence 1:NP_524314.2 Gene:Ugt35A1 / 41334 FlyBaseID:FBgn0026315 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_021332080.1 Gene:LOC571561 / 571561 -ID:- Length:206 Species:Danio rerio


Alignment Length:220 Identity:48/220 - (21%)
Similarity:87/220 - (39%) Gaps:43/220 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGILLIGLIWLFAANADEGVQSSRILAVFPFPGRSQYIFAEQFMKELAHRGHNVTVI----NTFG 70
            |.:.::.|:..|:|.     :...:|..  |...|.:|..:..::.|..|||||||:    :.|.
Zfish     3 LVVCVLALLTAFSAG-----ECGNVLVW--FTEGSHWINLKIVLETLIDRGHNVTVLVPDASIFM 60

  Fly    71 SDKNEPNF--RVIGAKK------------IHEIMAAFGNADYTQTASQ-WQMLTMTTQFLNLLTT 120
            .:|....|  :.....|            :|..|......:..|...: :|:::...|.......
Zfish    61 HEKESDRFSYQHFSVSKSTQDMQDSLNDFLHFSMYEMDRLNLLQIHIRLYQLISKDQQLCLAYCN 125

  Fly   121 SILDDAAVKDLLNSGEKFDLVIMEAV--QTEALFGLIQHFGAETIGIS-----SYGTDTHIDELM 178
            ..|....:.|.|.. ||||:::.:.:  .:|.|        ||.:.|.     .:.....::.:.
Zfish   126 GALKSPELMDKLLQ-EKFDVMLADPIFPCSEVL--------AEKLDIPLVYTLRFSIAHTMERMC 181

  Fly   179 GNI-SPLSYNPLLLSSRTEQMDFKD 202
            |.| :||||.|..:|..|::|.|.:
Zfish   182 GQIPAPLSYVPGAISKLTDKMSFTE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35A1NP_524314.2 egt 19..474 CDD:223071 46/211 (22%)
UDPGT 55..526 CDD:278624 40/175 (23%)
LOC571561XP_021332080.1 UDPGT 20..>206 CDD:330975 44/196 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55988
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.