DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35A1 and ugt-57

DIOPT Version :10

Sequence 1:NP_524314.2 Gene:Ugt35A1 / 41334 FlyBaseID:FBgn0026315 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_509182.1 Gene:ugt-57 / 180969 WormBaseID:WBGene00017154 Length:558 Species:Caenorhabditis elegans


Alignment Length:31 Identity:8/31 - (25%)
Similarity:15/31 - (48%) Gaps:5/31 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LEQYQQQGTLPEWSPLLIDRKNICPPPPYEQ 112
            :|..|||..:|     :::.::.|..|...|
 Worm   123 MELAQQQNHMP-----VVEYQSRCSLPQRAQ 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35A1NP_524314.2 Glycosyltransferase_GTB-type 19..474 CDD:471961 8/31 (26%)
ugt-57NP_509182.1 GT1_Gtf-like <168..477 CDD:340817
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.