DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35B1 and UGT71C5

DIOPT Version :9

Sequence 1:NP_524313.2 Gene:Ugt35B1 / 41333 FlyBaseID:FBgn0026314 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_172204.1 Gene:UGT71C5 / 837235 AraportID:AT1G07240 Length:480 Species:Arabidopsis thaliana


Alignment Length:452 Identity:82/452 - (18%)
Similarity:154/452 - (34%) Gaps:136/452 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MQAARILAIFPFPGPSQYINVVPYLKELANRGHQVTSVNAFPQKKPVV---------------NF 66
            |:.|.::.: |.|.....::.:.:.|.|.|...:::.:.......|..               ..
plant     1 MKTAELIFV-PLPETGHLLSTIEFGKRLLNLDRRISMITILSMNLPYAPHADASLASLTASEPGI 64

  Fly    67 RDVFIPDVFNNYKELINELSGPMNLWQEN------NFINKFFVSVTRCVLTNKEVTETLLPPGKD 125
            |.:.:|::.:         ..|:.|...:      :||:|....:.:.:.               
plant    65 RIISLPEIHD---------PPPIKLLDTSSETYILDFIHKNIPCLRKTIQ--------------- 105

  Fly   126 HFDLIIVEALRSDAYYGFAAHFNAPI-----IGISTFGTDWNIDALV------GNESPLSYTPLA 179
              ||:    ..|.:..|.::|....|     :|:...|.:.|:.:.:      |....|.|.|  
plant   106 --DLV----SSSSSSGGGSSHVAGLILDFFCVGLIDIGREVNLPSYIFMTSNFGFLGVLQYLP-- 162

  Fly   180 TGGLTDRMTFLERLSNFVDTTVAWLNYRFVHMSEQEKMY---------AKYFPEA-------SKR 228
               ...|:|..|                |...|.:|:::         ||..|..       ...
plant   163 ---ERQRLTPSE----------------FDESSGEEELHIPAFVNRVPAKVLPPGVFDKLSYGSL 208

  Fly   229 VQLTDLNRNFSLVLLN----------QHFSLSFPRPYVPNMIEVGG-LHISHKPAP-----LPKD 277
            |::.:.......:|:|          :|||..  |.| |::..||. |:::.:..|     ..|:
plant   209 VKIGERLHEAKGILVNSFTQVEPYAAEHFSQG--RDY-PHVYPVGPVLNLTGRTNPGLASAQYKE 270

  Fly   278 LEEFIQGSGEHGVIYFSLGSNVLSKDLPADRKDLILKTFASLPQRVLW----KFEDDKLPGKP-- 336
            :.:::....:..|::...||..:   .||.:...|......:..|.:|    ....|..|.:|  
plant   271 MMKWLDEQPDSSVLFLCFGSMGV---FPAPQITEIAHALELIGCRFIWAIRTNMAGDGDPQEPLP 332

  Fly   337 --------SNVFISKWFPQPDILAHPKVKLFITHGGLLSTIESIHHGKPVLGLPFFYDQFLN 390
                    ....:..|.||.|||||.....|::|.|..|..||:.:|.|:...|.:.:|.||
plant   333 EGFVDRTMGRGIVCSWAPQVDILAHKATGGFVSHCGWNSVQESLWYGVPIATWPMYAEQQLN 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35B1NP_524313.2 egt 8..466 CDD:223071 82/452 (18%)
MGT 26..438 CDD:273616 80/443 (18%)
UGT71C5NP_172204.1 PLN02167 1..480 CDD:215112 82/452 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.